Xtog030710.1
Basic Information
- Insect
- Xanthia togata
- Gene Symbol
- -
- Assembly
- GCA_963853775.1
- Location
- OY970803.1:21861150-21862032[+]
Transcription Factor Domain
- TF Family
- SRF
- Domain
- SRF domain
- PFAM
- PF00319
- TF Group
- Helix-turn-helix
- Description
- Serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [2], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation [1]. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic α-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel β-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see (IPR002487).
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 14 0.0079 89 4.2 0.0 18 28 8 18 3 19 0.87 2 14 0.27 3e+03 -0.7 0.0 19 28 27 36 25 40 0.86 3 14 0.0093 1.1e+02 4.0 0.0 18 28 44 54 42 55 0.87 4 14 0.0088 99 4.1 0.0 18 28 62 72 60 74 0.88 5 14 0.2 2.3e+03 -0.3 0.0 18 28 81 91 80 92 0.86 6 14 0.053 6e+02 1.6 0.0 18 30 99 111 97 112 0.87 7 14 0.0092 1e+02 4.0 0.0 18 28 117 127 114 128 0.88 8 14 0.27 3e+03 -0.7 0.0 19 28 136 145 134 149 0.86 9 14 0.0093 1.1e+02 4.0 0.0 18 28 153 163 151 164 0.87 10 14 0.0088 99 4.1 0.0 18 28 171 181 169 183 0.88 11 14 0.0093 1.1e+02 4.0 0.0 18 28 190 200 188 201 0.87 12 14 0.27 3e+03 -0.7 0.0 19 28 209 218 207 222 0.86 13 14 0.0093 1.1e+02 4.0 0.0 18 28 226 236 224 237 0.87 14 14 0.0093 1.1e+02 4.0 0.0 18 28 244 254 242 255 0.87
Sequence Information
- Coding Sequence
- ATGGGTAGCAGATGGGTAGCAGGTCACTTCAAGAAACTTAGTGAACTGTCAATCCCAAGCATCAGATGGGTAGCAGGTCACTTCAAGCAACTTAGTGAACTGTCAATCCCAAGCACCATATGGGTAGCAGGTCACTTCAAGAAACTTAGTGAACTGTCAATCCCAAGCATCAGATGGGTAGCAGGTCACTTCAAGAAACTTAGTGAACTGTCAATCCCAAGCACCATATTATGGGTAGCAGGTCACTTCAAGAAACTTAGTAAACTGTCAATCCCAAGCATCAGATGGGTAGCAGGTCACTTCAAGCAACTTAGTGAACTGTCAATCCCATGCATCAGATGGGTAGCAGGTCACTTCAAGAAACTTAGTGAACTGTCAATCCCAAGCATCAGATGGGTAGCAGGTCACTTCAAGCAACTTAGTGAACTGTCAATCCCAAGCACCATATGGGTAGCAGGTCACTTCAAGAAACTTAGTGAACTGTCAATCCCAAGCATCAGATGGGTAGCAGGTCACTTCAAGAAACTTAGTGAACTGTCAATCCCAAGCACCATATTATGGGTAGCAGGTCACTTCAAGAAACTTAGTGAACTGTCAATCCCAAGCATCAGATGGGTAGCAGGTCACTTCAAGCAACTTAGTGAACTGTCAATCCCAAGCACCATATGGGTAGCAGGTCACTTCAAGAAACTTAGTGAACTGTCAATCCCAAGCATCAGATGGGTAGCAGGTCACTTCAAGAAACTTAGTGAACTGTCAATCCCAAGCATCAGATGGGTTCAGTGA
- Protein Sequence
- MGSRWVAGHFKKLSELSIPSIRWVAGHFKQLSELSIPSTIWVAGHFKKLSELSIPSIRWVAGHFKKLSELSIPSTILWVAGHFKKLSKLSIPSIRWVAGHFKQLSELSIPCIRWVAGHFKKLSELSIPSIRWVAGHFKQLSELSIPSTIWVAGHFKKLSELSIPSIRWVAGHFKKLSELSIPSTILWVAGHFKKLSELSIPSIRWVAGHFKQLSELSIPSTIWVAGHFKKLSELSIPSIRWVAGHFKKLSELSIPSIRWVQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -