Veme006777.1
Basic Information
- Insect
- Vollenhovia emeryi
- Gene Symbol
- -
- Assembly
- GCA_000949405.1
- Location
- NW:2268978-2271993[+]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 4.4e-28 3e-24 84.6 12.6 1 70 54 124 54 124 0.97
Sequence Information
- Coding Sequence
- ATGCATAAGAATGGACCACCACCACCTTATGAACCACCACCTTACGCGCCACCTGCTTACTCCCAAAATGTGGGAGGTGTTCCTCCAGCTAGTCCGTTTACACCTGCGCAAACTTATGCGAATGGGCCTACTATAGTCACAACTATTGTTCCGCTCGGGCCACAGTCGACTCATACAATCTGTCCACATTGCCATGCCGAAATAGATACATCAACAAAAACTGAACCTGGCATGATTGCTTATATCTCAGGTGTCATCATAGCACTGCTGGgATGTTGGTTTGGTTGCTGCTTGATTCCATGTTGCATTGATGAATGCATGGATGTTCATCATAACTGTCCAAACTGTAAAGCTTATCTGGGACGTCATAGAAGATAA
- Protein Sequence
- MHKNGPPPPYEPPPYAPPAYSQNVGGVPPASPFTPAQTYANGPTIVTTIVPLGPQSTHTICPHCHAEIDTSTKTEPGMIAYISGVIIALLGCWFGCCLIPCCIDECMDVHHNCPNCKAYLGRHRR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00738764;
- 90% Identity
- iTF_01269475; iTF_01271626; iTF_01267950; iTF_01270192; iTF_01523728; iTF_01267227; iTF_01270876; iTF_01268672; iTF_00868452; iTF_00899201; iTF_00128642; iTF_00016387; iTF_00015079; iTF_01476615; iTF_01422600; iTF_00126378; iTF_00867851; iTF_00130156; iTF_00774188; iTF_00869295; iTF_01354992; iTF_00417969; iTF_00452913; iTF_01355793; iTF_01477265; iTF_00127859; iTF_01423316; iTF_01099574; iTF_01421910; iTF_01424054; iTF_00127127; iTF_01228695; iTF_00182329; iTF_01477978; iTF_01016219; iTF_00015741; iTF_00181661; iTF_00770045; iTF_00017022; iTF_00110206; iTF_00129407; iTF_01077856; iTF_01229429; iTF_01229428; iTF_00280350; iTF_01406180; iTF_00885575; iTF_00766066; iTF_01408725; iTF_01408726; iTF_01406903; iTF_01409625; iTF_01407836; iTF_00265350; iTF_00385958; iTF_01256078; iTF_00393965; iTF_00757040; iTF_00264690; iTF_01262144; iTF_00182977;
- 80% Identity
- -