Vcin025147.1
Basic Information
- Insect
- Villa cingulata
- Gene Symbol
- Aef1
- Assembly
- GCA_951394055.1
- Location
- OX596021.1:27301419-27301931[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.6 8.6e+03 -1.8 0.0 11 26 20 35 18 43 0.75 2 5 0.0027 39 5.7 0.2 22 49 44 71 39 74 0.86 3 5 6.3e-06 0.09 14.1 0.0 21 52 71 102 67 103 0.89 4 5 0.0015 21 6.5 0.2 21 51 99 129 96 130 0.87 5 5 7.1e-05 1 10.8 0.1 21 47 127 153 125 158 0.89
Sequence Information
- Coding Sequence
- ATGACAGAATTTCAGGTTACAATCGATACAAAAGATTTCCAAAATAATTTGGAATCTGGTGAAGATGATCCGATGTCAAGAGCATTAAGTCGTACTACTGTAACTGTTGCTGTACCAAATCAACCGGTTGAAAAACCATTTCAATGTAATGTATGTGAAAGAAGATTTCGTCAATTAAGTACATTGACAAATCATGTTAAAATACATACTGGTGAAAAACcatttaaatgtaatatatgcGAAAAACATTTTCGTCAATCCAGTACATTAAcgaatcatttaaaaattcataccGGTGAAAAACCGTTCAATTGTCAATATTGTTGTAAACAATTTCGTCAACTAAGTACATTaacaaatcatttaaaaattcatactGGTGAAAAACCATTTGAATGTGCCGTCTGTAAAAAACAGTTCCGTCAATCAAGTACATTGaataatcatataaaaattcatgttatgGATAAACTTTATTTACCATTTGAAATTAAAACCGAAGATGAAGGATGA
- Protein Sequence
- MTEFQVTIDTKDFQNNLESGEDDPMSRALSRTTVTVAVPNQPVEKPFQCNVCERRFRQLSTLTNHVKIHTGEKPFKCNICEKHFRQSSTLTNHLKIHTGEKPFNCQYCCKQFRQLSTLTNHLKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKLYLPFEIKTEDEG
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00203877;
- 90% Identity
- iTF_01519737;
- 80% Identity
- iTF_01519737;