Vtam013462.1
Basic Information
- Insect
- Vanessa tameamea
- Gene Symbol
- litaf
- Assembly
- GCA_037043105.1
- Location
- CM073294.1:6997317-6997925[+]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 7.4e-23 2.3e-19 69.8 13.7 2 69 101 172 100 173 0.84
Sequence Information
- Coding Sequence
- atggcTACAAATAATTATCCTCCGAATACCTCAAACATCCCACCTTGTAATACGAATGATCTTCCACCACCATACTCTGCTGTTGTAGGTAATCCCCAGTATGGTTTTGTTGCACCTCCAGGTGAACAATTTCCTGCCGCGGGTGGTGTCTTTCCGCAACCAAAACAATTCACTCCAGTAGGAGTCTATCCTCATCCAACAGTCTTACCTACCTCTGCTCAACCTCAAACTGATGTTCCGCCTCCGCCTCCTGGTATGTCTGTGCCTGTTGGTGTCGTGATGCCTCCTGCGGTTGGTAGTGAACCCACCACAGTGACTTGCTACAACTGTGGCAAAGTTGTTACAACAAGGGTTACATATACAACAGCTTGGCATACTCATCTCGTAGCTGGTTCAATTTGTGTAATCACTAtggTTTGTTCATTATGTTGTCTTGGACTCATACCTTATTGCTTCGACACCTTCAAGGATGCTGAACACTACTGCCCCAACTGCAGTACCTTTATTGGTAAAAGCAACAAAtgctaa
- Protein Sequence
- MATNNYPPNTSNIPPCNTNDLPPPYSAVVGNPQYGFVAPPGEQFPAAGGVFPQPKQFTPVGVYPHPTVLPTSAQPQTDVPPPPPGMSVPVGVVMPPAVGSEPTTVTCYNCGKVVTTRVTYTTAWHTHLVAGSICVITMVCSLCCLGLIPYCFDTFKDAEHYCPNCSTFIGKSNKC
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00825251; iTF_00843991; iTF_00696184; iTF_01506844; iTF_01507743; iTF_00205736; iTF_01021899; iTF_00256529; iTF_00257479; iTF_00213090; iTF_00247716; iTF_00214094; iTF_00723643; iTF_00160348; iTF_00248607; iTF_01182343; iTF_00779946; iTF_00780717; iTF_00782317; iTF_00458542; iTF_00778478; iTF_00781492; iTF_00777687; iTF_00776473; iTF_00783098; iTF_00775739; iTF_00621693; iTF_00774941; iTF_00777150; iTF_00779200; iTF_00796995; iTF_00897466; iTF_00353735; iTF_00354764; iTF_00959847; iTF_01034210; iTF_00843182; iTF_00959090; iTF_00960602; iTF_00462043; iTF_01035131; iTF_00802506; iTF_00954081; iTF_00642888; iTF_01151738; iTF_00955277; iTF_01079534; iTF_01081217; iTF_01080388; iTF_01078740; iTF_01018256; iTF_01019101; iTF_00985664; iTF_00986815;
- 90% Identity
- iTF_00825251;
- 80% Identity
- -