Basic Information

Gene Symbol
-
Assembly
GCA_036926305.1
Location
JAXCHB010000056.1:11621656-11622516[+]

Transcription Factor Domain

TF Family
zf-GAGA
Domain
zf-GAGA domain
PFAM
PF09237
TF Group
Zinc-Coordinating Group
Description
Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 3 8.5e-06 0.51 13.1 0.0 20 48 42 70 36 76 0.89
2 3 8.5e-06 0.51 13.1 0.0 20 48 108 136 102 142 0.89
3 3 0.011 6.5e+02 3.2 0.0 20 27 174 181 168 191 0.82

Sequence Information

Coding Sequence
ATGTGGCGCCATGGCATGGTAGTAGGGCTGGGCACTCGTCTCAGCCTGCCACGTGTCGACGTTTACCGCTTGGGGTTTACGTCGTGCACTTATGTGGCGCCATGGCATGGTAGTAGGGCTGGGCACTCGTCTCAGCCTGCCACGTGTCGACCCTGCCACGTGTCGACGTTTACCGCTTGGGGTTTACGTCGTGCACTTATGTGGCGCCATGGCATGGTAGTAGGGCTGGGCACTCGTCTCAGCCTGCCACGTGTCGACGTTTACCGCTTGGGGTTTACGTCGTGCACTTATGTGGCGCCATGGCATGGTAGTAGGGCTGGGCACTCGTCTCAGCCTGCCACGTGTCGACCCTGCCACGTGTCGACGTTTACCGCTTGGGGTTTACGTCGTGCACTTATGTGGCGCCATGGCATGGTAGTAGGGCTGGGCACTCGTCTCAGCCTGCCACGTGTCGACGTTTACCGCTTGGGGTTTACGTCGTGCACTTATGTGGCGCCATGGCATGGTAGTAGGGCTGGGCACTCGTCTCAGCCTGCCACGTGTCGACGTTTACCGCTTGGGGTTTACGTCGTGCACTTATGTGGCGCCATGGCATGGGTAGTAGGGCTGGGGTGTATGCCTTGGCGAGCTCGCCATGCTAAAAATAAAGAGCAACGAAGGCCTAAGCATTGCCTCCTGGGCGGCCTGTGGAAATATGCTTTCACTTCATAG
Protein Sequence
MWRHGMVVGLGTRLSLPRVDVYRLGFTSCTYVAPWHGSRAGHSSQPATCRPCHVSTFTAWGLRRALMWRHGMVVGLGTRLSLPRVDVYRLGFTSCTYVAPWHGSRAGHSSQPATCRPCHVSTFTAWGLRRALMWRHGMVVGLGTRLSLPRVDVYRLGFTSCTYVAPWHGSRAGHSSQPATCRRLPLGVYVVHLCGAMAWVVGLGCMPWRARHAKNKEQRRPKHCLLGGLWKYAFTS

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
-
90% Identity
-
80% Identity
-