Basic Information

Insect: Udea olivalis
Gene Symbol: -
Assembly: GCA_947369235.1
Location: OX376353.1:16925964-16928026[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 2.3e-06 0.00023 22.2 1.7 1 23 173 195 173 195 0.98

2 8 2.2e-08 2.2e-06 28.5 1.6 3 23 203 223 201 223 0.98

3 8 7.6e-05 0.0076 17.4 0.3 1 23 229 251 229 251 0.98

4 8 1.7e-05 0.0017 19.5 1.7 2 23 353 374 352 374 0.96

5 8 2.2e-09 2.2e-07 31.7 1.6 1 23 380 402 380 402 0.98

6 8 0.0018 0.18 13.1 0.6 3 23 410 430 408 430 0.97

7 8 4.7e-05 0.0047 18.1 1.5 1 23 436 458 436 458 0.99

8 8 0.015 1.5 10.2 0.8 1 23 464 488 464 488 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	2.3e-06	0.00023	22.2	1.7	1	23	173	195	173	195	0.98
2	8	2.2e-08	2.2e-06	28.5	1.6	3	23	203	223	201	223	0.98
3	8	7.6e-05	0.0076	17.4	0.3	1	23	229	251	229	251	0.98
4	8	1.7e-05	0.0017	19.5	1.7	2	23	353	374	352	374	0.96
5	8	2.2e-09	2.2e-07	31.7	1.6	1	23	380	402	380	402	0.98
6	8	0.0018	0.18	13.1	0.6	3	23	410	430	408	430	0.97
7	8	4.7e-05	0.0047	18.1	1.5	1	23	436	458	436	458	0.99
8	8	0.015	1.5	10.2	0.8	1	23	464	488	464	488	0.95

Sequence Information

Coding Sequence: ATGCAGCACCAGAGCCCCGGCGGTCCCTCGCCGCAGCCGGAGCCGCAGCTCGCCTCTCCCGCCCCGTCACCTTACCCGCCAGTACCACCGCCTCCAGACCCTACCGGAGCCGCTGAAGACGCTGCCCAACAACTCGCCCAACAACAGGCCCAGCAACAAGCGCAGCAACAGCAGCAGCAACAACAGACCTCCCCTGAACACATGCAAGTCGACCAGCAACTGCAAAGCCAACCGCAGCCGCAAACCCAAGATCACCTGGATAGAACGCCATGCTTCGTTCCGCAACCCGATCTGCAGCAGCAGTATACGCCGTATTTTAAAGAGACCAGACCGACGAGTCATATGCTAGGAACCGGTGGATTTCCGCTGCACTACTTGAAACAGAACGGTGGAGTGCTATCGCTAGAAGGGCCGCTGGATCAATACGCAGCGCCGGAGTTACGTCATTTGCCAGATATAGTGCAGCCAGAGCAGCCAAAGccgcgcaagcacaatcccaattcagaattacggctgttcaagtgccttacgtgcggcaaggacttcaagcagaagtcgacgctgctgcagcatgagcgcatccacactgactcgcggccgtacgggtgcccggagtgcggcaagcggttccggcagcagtcgcatctcacgcagcacctccgcatccacgcgaatgagaagccttacgcgtgtgtctactgcccgcgctccttccgccagcgcgccatcctcaaccagcacctgcgcatccattccgATGTCTCGCCGCATCTAATATTCAAGAACGGGACGACGCCTACGCTATGGCCGCAAGATGTGCCGTTTCCGGGTGATGAGAACAAGGAGGAAATACAGTCGACGTACGGAGACACGGACCAGAACGGCGAGCAACGCGGCTCCTGCTTCTCTCCGGGCGACACGGCGCAGTACCCGGCTTACTTCAAGGACACCAAAGGCTTGAACCACACCGTTTTCGGCTCCAGTCTCTCTTTACAATATTTGAAGGGTGGCAAACTGCCAGACGTTCTCGGCGGCCGAGCCATGCCGCTGTACGTCCGCTGcccgatctgccaaaaagagttcaaacaaaaatcaacgctactgcagcacggctgcattcatatagagtcgcggccgtacccttgcccggaatgcggaaagcgcttccggcaacaatcgcatctgacgcaacatcttcgcatccacaccaacgaaaaaccatacgggtgcgtatactgtcctagatttttccgccagcggacgatcctcaaccagcatctccgcatacacaccggggagaagccgtataagtgtactcaatgcggcaaagacttcagacagaaagcgattctggatcagcacacgcggacgcaccagggcgaccggccgttctgctgtccgatgccgaactgccggcggcggttcgcaaccgagcctgaggtgaagaaacatatcgataatcacatgaacccgcacgcggcgaaagCAAGGCGCGCCGACGCGGCGAAGACCCCGCGGCCGCTGCCACCGGCGGCGGCGGTGGTGAAGCCGGAGCTATACTTCCCGCAGTGCTACGCGCCACCCTTCCAGCAGTTTCCTCCGGGCGCGACGGAGTTCAAGCCGGTCGTGGGTCCGGGCGCGCCGGTGGCCTGCCTGCCCGCCCAGTGA
Protein Sequence: MQHQSPGGPSPQPEPQLASPAPSPYPPVPPPPDPTGAAEDAAQQLAQQQAQQQAQQQQQQQQTSPEHMQVDQQLQSQPQPQTQDHLDRTPCFVPQPDLQQQYTPYFKETRPTSHMLGTGGFPLHYLKQNGGVLSLEGPLDQYAAPELRHLPDIVQPEQPKPRKHNPNSELRLFKCLTCGKDFKQKSTLLQHERIHTDSRPYGCPECGKRFRQQSHLTQHLRIHANEKPYACVYCPRSFRQRAILNQHLRIHSDVSPHLIFKNGTTPTLWPQDVPFPGDENKEEIQSTYGDTDQNGEQRGSCFSPGDTAQYPAYFKDTKGLNHTVFGSSLSLQYLKGGKLPDVLGGRAMPLYVRCPICQKEFKQKSTLLQHGCIHIESRPYPCPECGKRFRQQSHLTQHLRIHTNEKPYGCVYCPRFFRQRTILNQHLRIHTGEKPYKCTQCGKDFRQKAILDQHTRTHQGDRPFCCPMPNCRRRFATEPEVKKHIDNHMNPHAAKARRADAAKTPRPLPPAAAVVKPELYFPQCYAPPFQQFPPGATEFKPVVGPGAPVACLPAQ

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00790532;
90% Identity: iTF_01363324;
80% Identity: -