Basic Information

Insect: Udea ferrugalis
Gene Symbol: bs_2
Assembly: GCA_950022985.1
Location: OX465524.1:2743896-2744354[-]

Transcription Factor Domain

TF Family: SRF
Domain: SRF domain
PFAM: PF00319
TF Group: Helix-turn-helix
Description: Serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [2], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation [1]. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic α-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel β-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see (IPR002487).
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 1 1.7e-10 1.4e-06 28.5 0.5 1 23 112 134 112 135 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	1	1.7e-10	1.4e-06	28.5	0.5	1	23	112	134	112	135	0.95

Sequence Information

Coding Sequence: ATGGACGCGCCCGGCGGAGCGCGGGAGCCCCGCTTCGGGTCGCCTTACGGTATGGGACTCCTTGGAGAGATGCCGGATATGTATGGAGCAGGCCGGCCGCCCAGCTCACTCGGCGGAGGCCTGAGGCCAGGCATGCAGCCCTGCCCCATGCCCCGAGCTGGCGTCAAGAGACCTTCAGACCAGTGCTACGATGAGAGACCCTCCCAGAGTGTTGGGCTCGACCATTGCCCCATGCCTGATATAGCAGACGATGGATATGCTTCCCTTCAGCCTAAGAAATCACCACCATCTAATGGTAAAAAGACCAAAGGGCGCGTCAAGATTAAGATGGAATACATAGATAACAAACTGCGGCGGTACACGACGTTCTCAAAGCGAAAGACTGGGATTATGAAGAAGGTGGGTGCGGAGACCGTTTTTGGCAATATTCCATATGGGCCAGTCAGGGAATGCTCATAG
Protein Sequence: MDAPGGAREPRFGSPYGMGLLGEMPDMYGAGRPPSSLGGGLRPGMQPCPMPRAGVKRPSDQCYDERPSQSVGLDHCPMPDIADDGYASLQPKKSPPSNGKKTKGRVKIKMEYIDNKLRRYTTFSKRKTGIMKKVGAETVFGNIPYGPVRECS

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00702881; iTF_00704993; iTF_00811010; iTF_00700101; iTF_00696454; iTF_00703944; iTF_01161353; iTF_00705994; iTF_00697324; iTF_00699149; iTF_00701969; iTF_00701046; iTF_00698295; iTF_01171450; iTF_00321574; iTF_00726339; iTF_00037796; iTF_01527207; iTF_00364008; iTF_01439917; iTF_01526000; iTF_00907029; iTF_00906134; iTF_00622813; iTF_00036704; iTF_00710180; iTF_01561985; iTF_00357481; iTF_00874441; iTF_00358540; iTF_00923661; iTF_00710994; iTF_00876149; iTF_00875286; iTF_01193568; iTF_01091910; iTF_00801827; iTF_00954441; iTF_00277339; iTF_01205678; iTF_01202442; iTF_01203216; iTF_00771061; iTF_01437028; iTF_00761659; iTF_01416763; iTF_01230565; iTF_00869612; iTF_00850723; iTF_00973763; iTF_00851784; iTF_01026164; iTF_01118292; iTF_00111644; iTF_01041734; iTF_01172358; iTF_00055394; iTF_01436070; iTF_00889194; iTF_01260083; iTF_00007992; iTF_00832987; iTF_00361605; iTF_00661261; iTF_00662204; iTF_00856607; iTF_01443824; iTF_00909691; iTF_01342198; iTF_00408443; iTF_00831207; iTF_00237558; iTF_00250440; iTF_00818321; iTF_01119313; iTF_01117193; iTF_00634463; iTF_01332689; iTF_00282376; iTF_00281312; iTF_00823022; iTF_01197704; iTF_01491918; iTF_01360596; iTF_00794587; iTF_00441472; iTF_00677597; iTF_01182868; iTF_01170580; iTF_00035639; iTF_00034710; iTF_01317271; iTF_01340090; iTF_00122378; iTF_00120491; iTF_01338738; iTF_01246964; iTF_01340091; iTF_00074491; iTF_01490107; iTF_00858524; iTF_01010337; iTF_01358850; iTF_00428102; iTF_00819146; iTF_00450094; iTF_00787632; iTF_00063570; iTF_00341299; iTF_00859448; iTF_00428989; iTF_01429917; iTF_00290687; iTF_01134770; iTF_01135734; iTF_00049885; iTF_00123357; iTF_00121425; iTF_00345789; iTF_00208862; iTF_00207894; iTF_00011967; iTF_00206048; iTF_00666514; iTF_00206973; iTF_00377088; iTF_00723936; iTF_01569312; iTF_00647971;
90% Identity: iTF_00720273; iTF_00013002; iTF_01302318; iTF_00640303; iTF_00075521; iTF_01281318; iTF_00076512; iTF_01279235; iTF_00038754; iTF_00771906; iTF_01119313; iTF_00647971; iTF_01547531; iTF_00125108; iTF_01182868; iTF_00832987; iTF_01569312; iTF_00726339; iTF_00037796; iTF_01527207; iTF_00364008; iTF_01439917; iTF_01526000; iTF_00907029; iTF_00906134; iTF_00622813; iTF_00036704; iTF_01437028; iTF_00172934; iTF_01436070; iTF_00284520; iTF_01335915; iTF_00382589; iTF_00035639; iTF_00034710; iTF_00736599; iTF_00007992; iTF_00682408; iTF_00683341; iTF_00681628; iTF_01334879; iTF_00889194; iTF_01333805; iTF_01443824; iTF_00187140; iTF_01208170; iTF_01209251; iTF_01028275; iTF_01031125; iTF_00888248; iTF_01030207; iTF_01029248; iTF_00006261; iTF_01081570; iTF_01083310; iTF_01312203; iTF_01316332; iTF_01317271; iTF_00112475; iTF_00761659; iTF_00049885; iTF_01503862; iTF_00237558; iTF_01071606; iTF_00364905; iTF_00960910; iTF_00408443; iTF_00907863; iTF_01340090; iTF_00122378; iTF_00120491; iTF_00121425; iTF_00667473; iTF_01338738; iTF_01246964; iTF_01340091; iTF_00123357; iTF_00000315; iTF_00001156; iTF_00007067; iTF_01251717; iTF_01415821; iTF_01416763; iTF_00074491; iTF_00758150; iTF_01094020; iTF_00745679; iTF_00147440; iTF_00374100; iTF_01094901; iTF_00924662; iTF_00124249; iTF_00375198; iTF_00449087; iTF_01490107; iTF_00345789; iTF_00947869; iTF_01075422; iTF_00185290; iTF_00186157; iTF_01221553; iTF_00327060; iTF_01166676; iTF_00637633; iTF_00908825; iTF_00072797; iTF_00146403; iTF_01220633; iTF_00011967; iTF_00206048; iTF_00666514; iTF_00206973; iTF_00723936;
80% Identity: -