Basic Information

Transcription Factor Domain

TF Family: PC4
Domain: PC4 domain
PFAM: PF02229
TF Group: Unclassified Structure
Description: This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.19 3.6e+03 -2.3 1.1 28 37 14 24 11 24 0.80

2 3 0.033 6.6e+02 0.0 0.1 28 37 32 41 26 41 0.72

3 3 1.4e-26 2.7e-22 78.1 0.4 1 51 58 109 58 110 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.19	3.6e+03	-2.3	1.1	28	37	14	24	11	24	0.80
2	3	0.033	6.6e+02	0.0	0.1	28	37	32	41	26	41	0.72
3	3	1.4e-26	2.7e-22	78.1	0.4	1	51	58	109	58	110	0.97

Coding Sequence: ATGTCAAAATCAAAGGAATACATATCAACTAGCAGCGATGACAGTGATGAGGATAAGAAGCCAAAGAAGAAGACCAGACATGTGAgcgacgaggaagaagagaaatctAGACCTAGTAAGAAGGCAAAGAAGGGGCcaagcgaaaaagaaaaagaaaaggaagataaCGTGTGGGATATAGGAAATAACCGAAAGGTCACCGTGCGAGAGTACAGAGGAAAACTATATGTCGATATCAGAGAAATGTACTTTGATGGCGAAGGCAACTTGAAACCCGGAAAGAAAGGAATTTCAATGACTACCCAACAATGGAGAACTTTCTTATCGATTACGGACGAGGTGGACAAATGCGTGAAGTCAAAGTCTTAA
Protein Sequence: MSKSKEYISTSSDDSDEDKKPKKKTRHVSDEEEEKSRPSKKAKKGPSEKEKEKEDNVWDIGNNRKVTVREYRGKLYVDIREMYFDGEGNLKPGKKGISMTTQQWRTFLSITDEVDKCVKSKS

Sequence clustering based on sequence similarity using MMseqs2