Trha024820.1
Basic Information
- Insect
- Troides rhadamantus
- Gene Symbol
- dl_1
- Assembly
- GCA_018246435.1
- Location
- DWLU01020070.1:1688-4414[-]
Transcription Factor Domain
- TF Family
- RHD
- Domain
- RHD domain
- PFAM
- PF00554
- TF Group
- Beta-Scaffold Factors
- Description
- Proteins containing the Rel homology domain (RHD) are eukaryotic transcription factors. The RHD is composed of two structural domains. This is the N-terminal DNA-binding domain that is similar to that found in P53. The C-terminal domain has an immunoglobulin-like fold (See PF16179) that functions as a dimerisation domain [1-2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1e-52 2.9e-48 166.2 0.1 1 122 62 186 62 187 0.95
Sequence Information
- Coding Sequence
- ATGTTTACGTTGTGTCCTCCCGTGCGCGCAGTGGACGCGATCTGCATTGCGGACCCGGCGTTCGATGCGCGCTCGGTAGCCGGCATGCCGCGGCCCGCGCCAGCTCTCGCCGcagccaccgccaccgccaccgccaccgcaccCGCAATGCCGATCAGCCCCGCGCcagccgccgcgcccgccgtgCGTATCGTCGAGCAGCCGGCCAGCAAGGCGCTCAGGTTTCGCTATGAATGCGAGGGCCGGTCGGCGGGTTCTATTCCCGGCGTCAACAGCACCAGTGAGAGGAAGACCTACCCGACCATAGAGATCAGCGGCTGCACCGGCAACGCCATCGTCGTGGTCTCCTGCGTCACTAAGGATCATCCTTACAAGCCGCACCCCCACAACCTGGTGGGTCGGGAGCGGTGCGAGCGCGGTGTGTGCACGGTGAAGGCGGAGCTGTCCGGCGACAGCACGCTGGTCTCCTTCAGTAACCTGGGCATCCAGTGCGTCAAGCGGAAGGATGTCGACGGGGCGCTGCGCACGCGCGAGGAGCTACGCGTCGATCCGTTCAAGAGTTAG
- Protein Sequence
- MFTLCPPVRAVDAICIADPAFDARSVAGMPRPAPALAAATATATATAPAMPISPAPAAAPAVRIVEQPASKALRFRYECEGRSAGSIPGVNSTSERKTYPTIEISGCTGNAIVVVSCVTKDHPYKPHPHNLVGRERCERGVCTVKAELSGDSTLVSFSNLGIQCVKRKDVDGALRTREELRVDPFKS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01145806;
- 90% Identity
- -
- 80% Identity
- -