Basic Information

Gene Symbol
lov_2
Assembly
GCA_947095525.1
Location
OX352745.1:5084209-5084967[+]

Transcription Factor Domain

TF Family
BTB
Domain
zf-C2H2|ZBTB
PFAM
PF00651
TF Group
Zinc-Coordinating Group
Description
The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 3.7e-24 1.2e-21 77.5 0.0 1 103 29 127 29 133 0.93

Sequence Information

Coding Sequence
ATGGACGACAAGCCGACCGCCGTCGGCGGCGAAGaacactacagtctgcgctggaacaaccaccaggcgcacttgctgcgctccttcgaggcgctgctgcatgccgagaccttggtagacgtgacactcgtgtgcgctgagcgccgcgtgcgcgcacacaaggtgctgcttggcgcctgcagcccactcttccgccggatattcagcgagaacccgtgcaagcaccctgtgatcgtgttgaaggatttccagggatgggaggtgcaggctgttgtggactttatgtaccgtggcgaggtttctgtagcgcaagagcaactcggaactgtgatacgggcgggagagtcactacaagttcgaggcttggcTGACCAAGATCGTGAGGAACATGCAAGGTCTCCGCCACCAACGCCGTTGGCGAGGAGCCCAGTGCAGACAACACCGCCGGCACCGTCACCACCAGTGAGCCCAGCAAGTCCTCAGCCGAGGCGGAAGCAAGCGCGTCCACGACGTCGCTCGGGAGAATCAGACACTCCAGAAAATTTATCGATGCGACGGTCTCCAAGCGGTGGATTAAAGGCAGTCCGATTATCACGACCGCGTTCACCACCAAAGCAGGAACAAGAGGAACCTGAAGCGGATGTGCCACCGCCACCGCGGATGTTCGCGCCACATCAGGACATGTTCCCACCAGTACCACCTGCAGCAGTCTCCGCGCTGTCACTGACACCACCACACAGTGAGTACCTACATTTTTAA
Protein Sequence
MDDKPTAVGGEEHYSLRWNNHQAHLLRSFEALLHAETLVDVTLVCAERRVRAHKVLLGACSPLFRRIFSENPCKHPVIVLKDFQGWEVQAVVDFMYRGEVSVAQEQLGTVIRAGESLQVRGLADQDREEHARSPPPTPLARSPVQTTPPAPSPPVSPASPQPRRKQARPRRRSGESDTPENLSMRRSPSGGLKAVRLSRPRSPPKQEQEEPEADVPPPPRMFAPHQDMFPPVPPAAVSALSLTPPHSEYLHF

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_01260264;
90% Identity
iTF_00001313; iTF_01192866; iTF_01538922; iTF_01152320; iTF_01502235; iTF_01533218; iTF_00301348; iTF_00712075; iTF_00122563; iTF_00125251; iTF_00406883; iTF_00043717; iTF_00040036; iTF_00041043; iTF_00041942; iTF_00042806; iTF_00701214; iTF_00833221; iTF_01302533; iTF_00681766; iTF_00683490; iTF_00682573; iTF_00834790; iTF_00736743; iTF_00027005; iTF_00027915; iTF_00432383; iTF_00433294; iTF_01085543; iTF_01360839; iTF_00823176; iTF_00973929; iTF_00441674; iTF_01197931; iTF_00044643; iTF_00827139; iTF_01084419; iTF_00685606; iTF_01532259; iTF_00445355; iTF_00928853; iTF_00818459; iTF_01437223; iTF_01064812; iTF_00791344; iTF_00889393; iTF_00932797; iTF_00926760; iTF_00250627; iTF_01209452; iTF_00390548; iTF_00033050; iTF_01440232; iTF_00908067; iTF_00038993; iTF_01340369; iTF_00147670; iTF_00831383; iTF_01441242; iTF_00374363; iTF_01095099; iTF_00071644; iTF_00383849; iTF_00724073; iTF_01208426; iTF_00173218; iTF_01425252; iTF_01264837; iTF_00018311; iTF_00450311; iTF_00667691; iTF_00017484; iTF_00302285; iTF_00758414; iTF_00143186; iTF_00649267; iTF_00119733; iTF_00650168; iTF_00425599; iTF_00913760; iTF_00948036; iTF_01282500; iTF_01125609; iTF_00637838; iTF_00968174; iTF_00824020; iTF_01401430; iTF_00931607; iTF_01279417; iTF_00318220; iTF_00365069; iTF_00677805; iTF_00037966; iTF_00177326; iTF_00282574; iTF_00809318; iTF_01260264; iTF_01285704; iTF_00810257; iTF_00634638; iTF_01071758; iTF_00961077; iTF_00355344; iTF_00752212; iTF_01221744; iTF_01280528; iTF_00171985; iTF_00050092; iTF_01172529; iTF_00284690; iTF_00035873; iTF_00034925; iTF_00806866; iTF_01090931; iTF_00737619; iTF_01076684; iTF_00185461; iTF_00707124; iTF_01166868; iTF_00822113; iTF_01247265; iTF_00274563; iTF_00123526; iTF_01526214; iTF_00636647; iTF_01339081; iTF_00449325; iTF_00906319; iTF_00124432; iTF_00907184; iTF_01342355; iTF_01094197; iTF_00745943; iTF_01527479; iTF_01093276; iTF_00364189; iTF_00924926; iTF_01362526; iTF_00120674; iTF_00121605; iTF_00794817; iTF_01361799; iTF_00726604; iTF_00909006; iTF_00036976; iTF_00375476; iTF_00281529; iTF_00273760; iTF_00448277; iTF_00382813; iTF_01331829; iTF_01402825; iTF_00204469; iTF_01334032; iTF_00958068; iTF_00922989; iTF_00840400; iTF_00195289; iTF_00356439; iTF_00709399; iTF_01230775; iTF_00772164; iTF_01029414; iTF_01170726; iTF_00300393; iTF_01220778; iTF_00951983; iTF_01026479; iTF_00850928; iTF_01503120; iTF_00267348; iTF_00638776; iTF_01529339; iTF_00851968; iTF_01119521; iTF_00111812; iTF_01118476; iTF_01117502; iTF_00341474; iTF_00075684; iTF_01377636; iTF_00076710; iTF_00327209; iTF_00640553; iTF_00345962; iTF_00648266; iTF_00811178; iTF_01251979; iTF_00007260; iTF_01083500; iTF_00361774; iTF_00869807; iTF_00994480; iTF_00825940; iTF_00186421; iTF_01416983; iTF_00012152; iTF_00013217; iTF_01337017; iTF_00275461; iTF_01504025; iTF_00290842; iTF_00063741; iTF_01429181; iTF_00761822; iTF_01416030; iTF_00405152; iTF_00467520; iTF_00468296; iTF_00000472; iTF_00150776; iTF_01341452; iTF_00651896; iTF_00674424; iTF_00077641; iTF_00661465; iTF_00686497; iTF_00697505; iTF_01336065; iTF_01161506; iTF_00700259; iTF_01183043; iTF_00909830; iTF_00703144; iTF_00632905; iTF_00706185; iTF_00696591; iTF_00698449; iTF_00856785; iTF_00699379; iTF_00377239; iTF_00663224; iTF_00321723; iTF_01099931; iTF_01219901; iTF_00704158; iTF_01528447; iTF_00705184; iTF_01509728; iTF_00888421; iTF_01027493; iTF_01031273; iTF_01028462; iTF_01030388; iTF_00785341; iTF_00033952; iTF_00178368; iTF_01075648;
80% Identity
iTF_01285704;