Temo017452.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Trisateles emortualis
Gene Symbol
sox-2
Assembly
GCA_947095525.1
Location
OX352732.1:20836852-20837514[-]

Transcription Factor Domain

TF Family
HMG
Domain
HMG_box domain
PFAM
PF00505
TF Group
Other Alpha-Helix Group
Description
High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 2.8e-26 2.4e-23 82.8 2.5 1 69 25 93 25 93 0.99

Sequence Information

Coding Sequence
ATGGCATATCAAGTAGAGCAGCAGATGACCCGGCAGCTACCGAAGATATCACGACAGTCAAACCCCTACCATATAAAGAGACCGATGAACGCTTTCATGGTCTGGTCAAGACTACAGCGAAAGAAAATCTCTATGATGAATCCTAAACTACACAATTCTGAGATTTCCAAACGCTTAGGACTCGAATGGAAGAGTTTGGATGAGATGGAGAAGAGACCGTTCATTGACGAAGCTAAAAGGTTAAGGATTAAACATATGCAGGATTATCCAGATTATAAGTATCGTCCTAGAAGAAAGAATAAGTCAGATACAGCACCGTTTGTTCCCCCACCTCTCTATACGACTAGAGATGCTTTTGTTGAAGTAGAACCTCGTCAGGACACTAATTACCAAGCTATATCGTATCCAGACCAATTTGTATACAACAACATGATCAGTTACACTGTACCATCGATGCCCCAGCCTACCTTCGTGCCAACTACTATCAGACCTAAAGAAGAGACGACAAATTTGGAACTAAAACCGCTGCCATCAATCGAGAGTATTTCTTCACGGCCCTTTGCTGTTGTCAACCAACAGATGATGGTAAAAGCTTATCAGGACCTGCATTACGTGCCCAGTGACGTAACTAGAATATCTTACCACTATCCATTTGGAGTTTAA
Protein Sequence
MAYQVEQQMTRQLPKISRQSNPYHIKRPMNAFMVWSRLQRKKISMMNPKLHNSEISKRLGLEWKSLDEMEKRPFIDEAKRLRIKHMQDYPDYKYRPRRKNKSDTAPFVPPPLYTTRDAFVEVEPRQDTNYQAISYPDQFVYNNMISYTVPSMPQPTFVPTTIRPKEETTNLELKPLPSIESISSRPFAVVNQQMMVKAYQDLHYVPSDVTRISYHYPFGV

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_01332697; iTF_00043489; iTF_00171745; iTF_00071426; iTF_00000323; iTF_00124259; iTF_00794595; iTF_00931395; iTF_00952707; iTF_01192707; iTF_01533923; iTF_00677604; iTF_01340100; iTF_00041765; iTF_00049893; iTF_00111653; iTF_00622821; iTF_01340101; iTF_01534821; iTF_00040806; iTF_00123366; iTF_01532006; iTF_00375207; iTF_00449095; iTF_01062791; iTF_01063751; iTF_00281320; iTF_00441480; iTF_00706952; iTF_00709224; iTF_00809128; iTF_00810056; iTF_01029256; iTF_00036713; iTF_00785993; iTF_00018154; iTF_00038762; iTF_00157194; iTF_01030218; iTF_01085226; iTF_01487690; iTF_00771915; iTF_00785195; iTF_00850731; iTF_01030219; iTF_00001164; iTF_00823884; iTF_00037805; iTF_00301165; iTF_00711853; iTF_00973773; iTF_01076493; iTF_01094029; iTF_00017326; iTF_00300206; iTF_00726350; iTF_01064654; iTF_01361614; iTF_00172943; iTF_00282383; iTF_00783471; iTF_00831215; iTF_01533039; iTF_01538735; iTF_00758160; iTF_00951824; iTF_00302097; iTF_00364017; iTF_00404913; iTF_00445169; iTF_00851793; iTF_01230577; iTF_01527217; iTF_00072146; iTF_00274418; iTF_01117202; iTF_00122387; iTF_00185299; iTF_00869619; iTF_00120500; iTF_00685428; iTF_01152148; iTF_00450101; iTF_00928693; iTF_01027317; iTF_01439925; iTF_00446134; iTF_00823030; iTF_01377462; iTF_00186167; iTF_00745687; iTF_00147448; iTF_00273592; iTF_00121433; iTF_01061881; iTF_00039802; iTF_00177114; iTF_01119322; iTF_01221562; iTF_01260090; iTF_01285530; iTF_01441082; iTF_01526010; iTF_00383643; iTF_00667483; iTF_01028283; iTF_01264603; iTF_01026172; iTF_01166684; iTF_01338748; iTF_01363100; iTF_00042621; iTF_00327069; iTF_00374109; iTF_00425373; iTF_00821821; iTF_01031133; iTF_01094909; iTF_01118301; iTF_01425053; iTF_00447134; iTF_00784382; iTF_00907038; iTF_00907870; iTF_00932542; iTF_01246974; iTF_01502078; iTF_00237567; iTF_00888255; iTF_00924671; iTF_00906144; iTF_01084256; iTF_01093088; iTF_01342208; iTF_01179479; iTF_01180298;
90% Identity
-
80% Identity
-