Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 9e-06 0.24 13.1 0.1 21 46 29 54 23 61 0.85

2 6 0.00054 14 7.4 0.0 21 44 85 108 78 113 0.89

3 6 0.013 3.4e+02 3.0 0.3 21 45 113 137 109 145 0.79

4 6 1.1e-05 0.28 12.8 0.0 21 46 169 194 163 202 0.85

5 6 0.04 1.1e+03 1.4 0.2 21 40 197 216 193 223 0.73

6 6 0.019 5.2e+02 2.4 0.0 21 44 225 248 219 257 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	9e-06	0.24	13.1	0.1	21	46	29	54	23	61	0.85
2	6	0.00054	14	7.4	0.0	21	44	85	108	78	113	0.89
3	6	0.013	3.4e+02	3.0	0.3	21	45	113	137	109	145	0.79
4	6	1.1e-05	0.28	12.8	0.0	21	46	169	194	163	202	0.85
5	6	0.04	1.1e+03	1.4	0.2	21	40	197	216	193	223	0.73
6	6	0.019	5.2e+02	2.4	0.0	21	44	225	248	219	257	0.82

Coding Sequence: ATGGAAGTACAAGCGAATGCAGGACTGTCGGACAGTGGAACAAGGATGAAAGAAAGCCTCATCGTGCACCGACGTATCCACACTAAAGAACTCCCACACACatgcgacgtttgcggacgaGCTTTCCGACAGAGCGGCGACTTCAACAggcatatgaggacacacactggcgacaaaccgttcgaatgcgaatattgtaaaaagtctttttctcGTCAATTCACCCTCAGTGTGcaccgacgtattcacacaaaagaacgcCCATACAAATGTGACGTTTGCGGAGGAGCTTTCCGAAAGAGCAGCGACTTGAAAGtgcatatgaggacacacaccggtgaacgtcctcacgcgtgtaagatatgctctaaaactttcaccCGAAATGAACATCTGGCAaatcacatgcgcacgcacaccggtgacaaaccgttcgaatgcgaatattgtaaaaagtatttttcccTGCAATCCACCCTCATTGTGcatcgacgtattcacacaaaagaactcccatacaaatgtgACGTTTGCGGAGGAGTTTTCCGAAAGAGCAGCGACTTGAACAggcatatgaggacacacaccggtgaacgtcctcacgtgTGTAAGATATGTTCTAAAACTTTCACACGAAATGAACATCTGGTAtatcacatgcgcacgcacaccggcgagcaGCCTTACGTATGCAAAACTTGCAACGAGGGCTTTACGTCCTCGACGAAATTAAAACTCCACACGCGCACTCACACGGAGGAAAAACCGTACCTCTGCGAAACCAGCAGAAAGTTATTTGTATGCAGTCACGATCTAAAGTTGCC
Protein Sequence: MEVQANAGLSDSGTRMKESLIVHRRIHTKELPHTCDVCGRAFRQSGDFNRHMRTHTGDKPFECEYCKKSFSRQFTLSVHRRIHTKERPYKCDVCGGAFRKSSDLKVHMRTHTGERPHACKICSKTFTRNEHLANHMRTHTGDKPFECEYCKKYFSLQSTLIVHRRIHTKELPYKCDVCGGVFRKSSDLNRHMRTHTGERPHVCKICSKTFTRNEHLVYHMRTHTGEQPYVCKTCNEGFTSSTKLKLHTRTHTEEKPYLCETSRKLFVCSHDLKL

Sequence clustering based on sequence similarity using MMseqs2