Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.018 2.6e+02 3.1 0.1 21 47 41 67 26 72 0.80

2 5 3.9e-05 0.58 11.6 0.4 23 45 71 93 67 96 0.90

3 5 7.1e-05 1.1 10.8 0.5 20 48 96 123 92 127 0.88

4 5 0.0097 1.4e+02 3.9 0.1 21 44 125 148 122 157 0.89

5 5 0.0013 20 6.7 0.0 23 46 155 178 152 182 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.018	2.6e+02	3.1	0.1	21	47	41	67	26	72	0.80
2	5	3.9e-05	0.58	11.6	0.4	23	45	71	93	67	96	0.90
3	5	7.1e-05	1.1	10.8	0.5	20	48	96	123	92	127	0.88
4	5	0.0097	1.4e+02	3.9	0.1	21	44	125	148	122	157	0.89
5	5	0.0013	20	6.7	0.0	23	46	155	178	152	182	0.90

Coding Sequence: ATGTCTGATGCCAATCAATTCCAATTGCAAGTAGCTCCCGTTTACAGCTGCAGGCGCTGCAAAAAGACTTTCTCCACAAAACGTGAACAAAATCTACATAAACGAGAAAATCACGAACACTCACAATCCTCGTACGAGTGCAAATTgtgctcaaaatttttctgtAACAATGGAAACTTGGAACGTCATATGAAGGTGCACAACGACATACGTCCATATACTTGTGCTATCTGTCAGAAATCATTTTCTCAGGCGGTTAACCTACAACGTCACTATTCAGTTCATAATGGTGAACGTCCTTATCAATGCAGTTTTTGTCAAAAGGCTTTTACGCAGCAAAGTAACATGCGTCGTCATGAGCTAACGCATACTGGTGAAAAACCATTTGGTTGCAAACGCTGTAATCGCTTCTTTTCTCAGCGCATCAATTTGAAAAAGCATATAATGGGCCATCTAAATACGCGTCCATATATGTGTGGCATGTGCCAAAAATCCTTTATACAGTCAGCCAACTATAAGAAGCATCTAAAAGTTCACGTCAAGGAGGGAAAATTTATTGATGAAGCAGCCGCTTTAGCAGCTATGGCGGATATTAAACCTAATCCTACAATTGAGCCTGTCGCTTTTGAATGTGCTCTCTGCCGTTCggtatttgataatttttcaagttttgaatCGCATGAAACTCGCTGCAATGGTATACCGAAAGATGTACATATTGAGAACACAAGAACTTCTATGGGTCAGTATGCGCCAATACAATATACAGTAACACATTTGGATGGAAATGAGATAATCGTGCAAACAAGTAgataa
Protein Sequence: MSDANQFQLQVAPVYSCRRCKKTFSTKREQNLHKRENHEHSQSSYECKLCSKFFCNNGNLERHMKVHNDIRPYTCAICQKSFSQAVNLQRHYSVHNGERPYQCSFCQKAFTQQSNMRRHELTHTGEKPFGCKRCNRFFSQRINLKKHIMGHLNTRPYMCGMCQKSFIQSANYKKHLKVHVKEGKFIDEAAALAAMADIKPNPTIEPVAFECALCRSVFDNFSSFESHETRCNGIPKDVHIENTRTSMGQYAPIQYTVTHLDGNEIIVQTSR

Sequence clustering based on sequence similarity using MMseqs2