Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 1.8 7.4e+02 -0.1 0.1 40 48 21 29 18 35 0.79

2 7 0.00063 0.26 10.9 0.1 23 48 33 58 28 63 0.88

3 7 0.016 6.5 6.5 0.0 23 48 62 87 59 92 0.86

4 7 0.0032 1.3 8.7 0.0 23 48 91 116 86 121 0.86

5 7 0.093 39 4.0 0.1 23 48 120 145 113 150 0.87

6 7 3.3 1.4e+03 -1.0 0.2 23 40 149 166 141 176 0.64

7 7 0.078 32 4.2 0.0 22 52 177 207 171 208 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	1.8	7.4e+02	-0.1	0.1	40	48	21	29	18	35	0.79
2	7	0.00063	0.26	10.9	0.1	23	48	33	58	28	63	0.88
3	7	0.016	6.5	6.5	0.0	23	48	62	87	59	92	0.86
4	7	0.0032	1.3	8.7	0.0	23	48	91	116	86	121	0.86
5	7	0.093	39	4.0	0.1	23	48	120	145	113	150	0.87
6	7	3.3	1.4e+03	-1.0	0.2	23	40	149	166	141	176	0.64
7	7	0.078	32	4.2	0.0	22	52	177	207	171	208	0.91

Coding Sequence: atgatcggagcaaaccctttgaatgcgAGATTTGCCACCAATCATATAGTCGCAGtcaCCCTCAAACGTCACttaaatgtagtacataatcggagtaagcccttcgaatgtgaaatttgtcacaaatcatttggagataGTAGTAACCTCAACAGGCACATAAACGCAGTACATAATCgcatcaaacccttcgagtgtgagatttgttacaaatcatttggaaaaaagagTGATTTCAATagacacataaatgcagtacataatcggagcaagcctttcgagtgtgatatttgtcacaaatcatttagagGCAAGGGTGACCTCAAAAGACACGTAAATTCTGTACATAATCacatcaaaccctttgaatgtgaaatttgtcacaaatcatttagatgCAAGGGTGACCTCAAAAGTCACGTAAATTCTGTACATAATCAGATCcgaccctttgaatgtgaaatttgtcgcaaatcatttgcacACAAATGCCATCTGAATGTTCAtgtaaatgcagtacataatcgtaacaaacccttcgaatgtggcatttgcaaaaaatcatttgcagaaaaaagtaGTCTCAATAAACATATAATTGCATTGCATCTGAACAAACCCATGTAA
Protein Sequence: MIGANPLNARFATNHIVAVTLKRHLNVVHNRSKPFECEICHKSFGDSSNLNRHINAVHNRIKPFECEICYKSFGKKSDFNRHINAVHNRSKPFECDICHKSFRGKGDLKRHVNSVHNHIKPFECEICHKSFRCKGDLKSHVNSVHNQIRPFECEICRKSFAHKCHLNVHVNAVHNRNKPFECGICKKSFAEKSSLNKHIIALHLNKPM

Sequence clustering based on sequence similarity using MMseqs2