Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.018 7.5 6.2 0.0 23 48 9 34 5 40 0.87

2 8 1.5 6.1e+02 0.2 0.0 23 44 38 59 35 66 0.82

3 8 0.29 1.2e+02 2.4 0.1 23 49 67 93 62 97 0.86

4 8 6e-05 0.025 14.2 0.1 23 48 96 121 93 126 0.90

5 8 0.00032 0.13 11.9 0.1 23 48 125 150 122 156 0.89

6 8 1.4 5.9e+02 0.2 0.1 23 44 154 175 150 184 0.70

7 8 0.77 3.2e+02 1.0 0.1 23 48 183 208 179 214 0.83

8 8 4.2 1.7e+03 -1.3 0.0 24 44 213 233 210 238 0.80

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.018	7.5	6.2	0.0	23	48	9	34	5	40	0.87
2	8	1.5	6.1e+02	0.2	0.0	23	44	38	59	35	66	0.82
3	8	0.29	1.2e+02	2.4	0.1	23	49	67	93	62	97	0.86
4	8	6e-05	0.025	14.2	0.1	23	48	96	121	93	126	0.90
5	8	0.00032	0.13	11.9	0.1	23	48	125	150	122	156	0.89
6	8	1.4	5.9e+02	0.2	0.1	23	44	154	175	150	184	0.70
7	8	0.77	3.2e+02	1.0	0.1	23	48	183	208	179	214	0.83
8	8	4.2	1.7e+03	-1.3	0.0	24	44	213	233	210	238	0.80

Coding Sequence: ATGAATGCattacataatcgtagcaagcCCTTCGAGTGtaacatttgtcacaaatcatttggccTGAAGAGTGATCTCAAACGTCACTTAAATGCCGTACATGATCGtgtcaaacccttcgaatgtgagatttgtcacaaatcatttggatataagGGAGacctcaaaaaacacataataacagtacatgatcgtagcacaCCCTTCGAGTGTATCATTTGTAACAAATCTTTTGGTCAAAAATGTTCCCTCAAATCTCATATAAATGCAATACATGTTCGGAGCAAACCTTTAGAGTGtaacatttgtcaaaaatcatttggacaaaatgGTAACCTTCACAGACACTTAAAATTAGTacataatcaaataaaaccctttgaatgtgatatttgtcacaaatcatttcgATATAAGGCAGACCTCAAAAGGCATATAAATTTAGTACATgatcagagcaaacccttcgaatgtaagatttgtcacaaatcatttggagaaaaaggtaCCCGGAATAGACATATAATTGTAGTACATGATCATattaaacccttcgaatgtgagatttgtcataaatcatttggttATAAACATCAGCTCAAAAGtcatataaatgcagtacatggtCATattaaacccttcgaatgtgagattagtcacaaatcattttcagaaaagggtaatctcaaaaaacacataataaaagtacatgatcgtagccgACCCTTCGAGTGTCAATag
Protein Sequence: MNALHNRSKPFECNICHKSFGLKSDLKRHLNAVHDRVKPFECEICHKSFGYKGDLKKHIITVHDRSTPFECIICNKSFGQKCSLKSHINAIHVRSKPLECNICQKSFGQNGNLHRHLKLVHNQIKPFECDICHKSFRYKADLKRHINLVHDQSKPFECKICHKSFGEKGTRNRHIIVVHDHIKPFECEICHKSFGYKHQLKSHINAVHGHIKPFECEISHKSFSEKGNLKKHIIKVHDRSRPFECQ

Sequence clustering based on sequence similarity using MMseqs2