Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.082 1.7e+02 3.2 0.1 51 69 12 30 9 31 0.80

2 9 0.05 1.1e+02 3.9 0.3 52 66 42 56 40 59 0.80

3 9 0.014 30 5.6 0.2 55 68 74 87 70 89 0.84

4 9 0.0023 4.9 8.2 0.2 53 69 101 117 97 118 0.86

5 9 0.034 72 4.4 0.2 53 66 130 143 126 147 0.81

6 9 0.0091 19 6.3 0.1 53 68 159 174 153 176 0.83

7 9 0.013 27 5.8 0.3 52 69 187 204 184 205 0.84

8 9 0.005 10 7.1 0.3 53 69 217 233 214 234 0.85

9 9 0.034 71 4.4 0.4 53 68 246 261 242 263 0.79

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.082	1.7e+02	3.2	0.1	51	69	12	30	9	31	0.80
2	9	0.05	1.1e+02	3.9	0.3	52	66	42	56	40	59	0.80
3	9	0.014	30	5.6	0.2	55	68	74	87	70	89	0.84
4	9	0.0023	4.9	8.2	0.2	53	69	101	117	97	118	0.86
5	9	0.034	72	4.4	0.2	53	66	130	143	126	147	0.81
6	9	0.0091	19	6.3	0.1	53	68	159	174	153	176	0.83
7	9	0.013	27	5.8	0.3	52	69	187	204	184	205	0.84
8	9	0.005	10	7.1	0.3	53	69	217	233	214	234	0.85
9	9	0.034	71	4.4	0.4	53	68	246	261	242	263	0.79

Coding Sequence: ATGTCAGCTTCGGAAGATCATAGAttggtaaataaaaatgacaaagtCCGTTCCAAATGCGATGAGTGTGGCAAACTCTTCggaattaaaagtaaattaatacAGCACATCGATGGAGCTCATTTTAAACTCAGAGAACACAGGTGCAAAGAATGTGAAAAGACATTTCGTTATAAAATTGACTTGAATAGACACATTGCGTCGATtcatggaaaaattttaaatcataaatgcAAAGAGTGTGGCAAACTTTTCGGACTAAAAAGTAAACTTATGACGCACGTAGATACAGTTCATTTGAAACTCAAAGATCACGAGTGCAAAGAATGTGGCAAATTTTTTGGGCGAAAGGATAATTTGTTGAAGCATATAGATGTAGTTCATTTGCAAATTAAAGAGCACATGTGCAAAGAGTGTGGTAAGACTTTCTTTTCTAAGGCTAACTTGAATAGACACTTTACCACggttcatgaaaaaatcaaagatcaCAAATGCGAAGAGTGTGGCAaattttttgcagaaaaagtGGTTTTGATGAGGCACCTAGATGTAGTTCATTTGAAACTCAAAGATCACGAGTGCAAAGAATGTGGCAAACCTTtcggacaaaaaaataatcttacgCAGCACATAGATCAAgttcatttgaaattgaaaaatcataaatgcGAAGAGTGCGGTAAACTTTTCGGACAAAAAGGTCATCTTATGCGGCATATGGATCTAATTCATTTGCAACTGAAAGAGCACAATTGCGAAGAGTGCGGCAAGTCTTTTAGTTATAAACATAGCTTAAACAAACACATTTTCACAGTACATGGAAAAATCAAAGATCACATGTGTGAAGAATGA
Protein Sequence: MSASEDHRLVNKNDKVRSKCDECGKLFGIKSKLIQHIDGAHFKLREHRCKECEKTFRYKIDLNRHIASIHGKILNHKCKECGKLFGLKSKLMTHVDTVHLKLKDHECKECGKFFGRKDNLLKHIDVVHLQIKEHMCKECGKTFFSKANLNRHFTTVHEKIKDHKCEECGKFFAEKVVLMRHLDVVHLKLKDHECKECGKPFGQKNNLTQHIDQVHLKLKNHKCEECGKLFGQKGHLMRHMDLIHLQLKEHNCEECGKSFSYKHSLNKHIFTVHGKIKDHMCEE

Sequence clustering based on sequence similarity using MMseqs2