Tvap014978.1
Basic Information
- Insect
- Trialeurodes vaporariorum
- Gene Symbol
- Kr
- Assembly
- GCA_011764245.1
- Location
- HIC:14609151-14609615[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.00023 0.51 10.5 0.1 21 45 6 30 2 34 0.90 2 4 0.00098 2.2 8.5 0.3 21 45 34 58 30 61 0.90 3 4 0.002 4.6 7.5 0.4 21 45 62 86 58 96 0.86 4 4 0.025 58 3.9 0.0 21 45 118 142 106 149 0.84
Sequence Information
- Coding Sequence
- ATGAGGACTCATACTGGTGAAAAACCTTTTCAATGTACTCACTGCAATGCAAAATTCAATCAAAGTTCTAGTTTGAGAAGTCACATGAGGACTCATACTGGTGAAAAACCATTTCAGTGCGCTCACTGCGATGCAAAATTCGCTAGAAGTAGCCACTTGCAACGTCACTTGAGGACTCACACTGGTGAAAAACCTTTTCAATGTACTCACTGCGATGCAAAATTCGCTAGAAGTAGTCACTTGCAACGTCACATGAGGACTCACACTGGTGAAAAACATTTTCAATGTACTCGTTGCAATTCAACATTTTCTGATAAAGGAACTTTGAAACTTCACATTGGGACTCACACTGGTGAAAAACCTTTTGAATGTGCTCATTGCAATGCAAAATTTTCTCGACAAAGAGCTTTGATAGTTCACATCAAAAGACATAGTGGTGAGAAACCATTCAAATTTACTTTGTGA
- Protein Sequence
- MRTHTGEKPFQCTHCNAKFNQSSSLRSHMRTHTGEKPFQCAHCDAKFARSSHLQRHLRTHTGEKPFQCTHCDAKFARSSHLQRHMRTHTGEKHFQCTRCNSTFSDKGTLKLHIGTHTGEKPFECAHCNAKFSRQRALIVHIKRHSGEKPFKFTL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01478394; iTF_01478304;
- 90% Identity
- iTF_01478394; iTF_01478304;
- 80% Identity
- iTF_01478394; iTF_01478304;