Tvap016797.1
Basic Information
- Insect
- Trialeurodes vaporariorum
- Gene Symbol
- -
- Assembly
- GCA_011764245.1
- Location
- HIC:49185125-49186669[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 0.0017 3.9 7.7 0.0 21 44 10 33 2 36 0.89 2 7 0.00044 1 9.6 0.1 20 46 37 63 34 70 0.87 3 7 0.36 8.1e+02 0.3 0.0 21 45 66 90 62 97 0.80 4 7 0.0072 16 5.7 0.0 21 46 94 119 77 126 0.85 5 7 0.23 5.3e+02 0.9 0.0 21 44 122 145 118 153 0.79 6 7 0.039 90 3.3 0.1 21 45 150 174 142 181 0.83 7 7 0.064 1.5e+02 2.7 0.1 21 46 178 203 174 210 0.84
Sequence Information
- Coding Sequence
- ATGAAGAGTCACATCAGAACACACACTGGTGAAAAACCATTTGAATGCACTCACTGCAATGCAAAATTTGCTCAAAAAATCAATCTGAAGAAGCACATCAGAACACATACCAGTGAAAAACCATTTGAATGCACTCACTGCAATGCTACATTTGCTCAAAAGACCGCTCTGGAGCGTCACATCAGAACACATACCGGTGAAAAACCATTTAAATGTACTCACTGCAATGCAAAATTTGCTGAAAAGAGCGTTCTAAAGAGTCACATCAGAACACATACTGGTGAAAAACCATTTAAATGTACTCACTGCATAGCAAAATTTTCTGTAAAGAGCAATCTGAAGAAGCACATCAGAACACATACTGGTGAGAAACCATTTGAATGCACTTACTGCAATGCAAAGTTTTCTCAAAAAGGCCACATGATCGAGCATATCAGAAAACATACTGGTGAAAAACCATTCGAATGCACTCAGTGCAATGCAAAATTTGCTCGCAAGAGCAATATGAAAAGTCACATCAGAACACATACTGGTGAAAAACCATTTGAATGCACTCACTGCAATGCAAAATTTGCTCACAAGAGCAATATGAAAAGTCACATCAGAACACACACTGGTGAAAAACCATTCAAACGCACTCACCGCAGTGCAAAGTTTCATTCTTCTCTTGACCGTGCCGCTATGTGCCGCTACGCGGCGCCTTTAGGCCCGGGCCTAGTCAGCCTTATTGGAAATCTGGGCCTGCCCATTGCAATGCAAAGTTTTTTTGAATGA
- Protein Sequence
- MKSHIRTHTGEKPFECTHCNAKFAQKINLKKHIRTHTSEKPFECTHCNATFAQKTALERHIRTHTGEKPFKCTHCNAKFAEKSVLKSHIRTHTGEKPFKCTHCIAKFSVKSNLKKHIRTHTGEKPFECTYCNAKFSQKGHMIEHIRKHTGEKPFECTQCNAKFARKSNMKSHIRTHTGEKPFECTHCNAKFAHKSNMKSHIRTHTGEKPFKRTHRSAKFHSSLDRAAMCRYAAPLGPGLVSLIGNLGLPIAMQSFFE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01478376;
- 90% Identity
- iTF_01478376;
- 80% Identity
- iTF_01478376;