Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.087 1e+03 1.6 0.1 22 52 17 47 7 48 0.81

2 7 0.0012 14 7.6 0.0 22 52 45 75 42 76 0.86

3 7 0.031 3.6e+02 3.0 0.0 21 48 72 99 70 103 0.85

4 7 0.00071 8.3 8.3 0.1 21 46 100 125 97 133 0.89

5 7 0.0026 30 6.5 0.0 21 51 132 162 127 163 0.86

6 7 0.00014 1.6 10.6 0.0 21 51 160 190 157 191 0.88

7 7 0.00055 6.4 8.6 0.3 21 46 188 213 186 218 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.087	1e+03	1.6	0.1	22	52	17	47	7	48	0.81
2	7	0.0012	14	7.6	0.0	22	52	45	75	42	76	0.86
3	7	0.031	3.6e+02	3.0	0.0	21	48	72	99	70	103	0.85
4	7	0.00071	8.3	8.3	0.1	21	46	100	125	97	133	0.89
5	7	0.0026	30	6.5	0.0	21	51	132	162	127	163	0.86
6	7	0.00014	1.6	10.6	0.0	21	51	160	190	157	191	0.88
7	7	0.00055	6.4	8.6	0.3	21	46	188	213	186	218	0.90

Coding Sequence: ATGCAAACTACCCAGGAGTTGAAACCGGCAGAAAAGGTGCCTAGCTGCACTAAACCTTTCCAATGTACCGAGTGTGATAAACAGTTCCGACAGCTAAGCACATTAACGAATCACATGAAGATTCACACAGGTGATAAACCCTATAAGTGCACAATATGTTCCAAGGAATTTCGTCAGACCACGACACTTTCCAATCACATAAAAATCCACACAGGAGAAAAGCCATTCAACTGCACATATTGTGGCAAACAATTTCGACAGTTGAGTACACTTTCTAATCACTTTAAAATTCATACAGGAGAAAAGCCGTACGAGTGCTCTGTGTGCGGCAAACAGTTTCGGCAATCCAGCACACTAAACAGCCACGTGAGAATCCACTCGGATGAGAAGTATTCTGTGAAGCCGTTCAAGTGCAGCATGTGCCCCAAGGAGTTCCGACAGACTACGACCCTCTCAAACCACCTGAAAATTCACACAGGTGAGAAACCCTACACTTGTACATATTGCAGCAAAAGTTTTAGACAGACAGGGACACTATCGAATCATCTAAAAATACACACTGGGGAAAAACCCTACGAGTGCTCAGTGTGCCGAAAACAGTTTCGTCAATCGAGCACGCTAAACTCTCACATACGAATCCACACggaggacaaaatatGTAAAACGTCCCCTTCGCCTCTGCCCTCGACATTGACCACAATCACGATGAAGCTGGAGGACATCAAGCCACTGTACACGATCATATAA
Protein Sequence: MQTTQELKPAEKVPSCTKPFQCTECDKQFRQLSTLTNHMKIHTGDKPYKCTICSKEFRQTTTLSNHIKIHTGEKPFNCTYCGKQFRQLSTLSNHFKIHTGEKPYECSVCGKQFRQSSTLNSHVRIHSDEKYSVKPFKCSMCPKEFRQTTTLSNHLKIHTGEKPYTCTYCSKSFRQTGTLSNHLKIHTGEKPYECSVCRKQFRQSSTLNSHIRIHTEDKICKTSPSPLPSTLTTITMKLEDIKPLYTII

Sequence clustering based on sequence similarity using MMseqs2