Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.025 1.6e+02 3.5 0.4 4 15 72 83 69 84 0.77

2 3 4 2.6e+04 -3.5 1.3 6 7 98 99 95 101 0.48

3 3 9.8e-09 6.4e-05 24.0 6.9 8 21 111 124 108 125 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.025	1.6e+02	3.5	0.4	4	15	72	83	69	84	0.77
2	3	4	2.6e+04	-3.5	1.3	6	7	98	99	95	101	0.48
3	3	9.8e-09	6.4e-05	24.0	6.9	8	21	111	124	108	125	0.91

Coding Sequence: ATGGCTAAATTGGCACCTAAATACGTTGGCCCTTATGAAACATTAAAGCCATTTTATGACGAGGGAGAGCCAGTGGAGAGCGACGATGAACAGGAAATCGAAGAAGAAGACAACACCCGACCCCCGGGGGATTCTAGCGAAACGGCGAAGCGCGATCCGCCGCATGCGAGAACTCAGTTGCCAGCGGGCACTGAGAAAAACCAGGACAGTGTTGGTGCTCCTACGCAAATTCGAGAGAGAGGTAGGCCTAGGAAGACGGCGTTCGTGACTCAAAGAATGGCCGATCCTACTCCCACGCCTACCAACACTGTAACTATTGCGAGCGAGCCCCCTGCGAGACCGCGCGGCCGACCTAAAGGGTCAAAGAATCGCGTACTAACCAGCGATAACGTTTCCGTTAGCCCCCGGAGAACACGCGCGAATCCGAACCTGGGTTTCCGAGGATAA
Protein Sequence: MAKLAPKYVGPYETLKPFYDEGEPVESDDEQEIEEEDNTRPPGDSSETAKRDPPHARTQLPAGTEKNQDSVGAPTQIRERGRPRKTAFVTQRMADPTPTPTNTVTIASEPPARPRGRPKGSKNRVLTSDNVSVSPRRTRANPNLGFRG

Sequence clustering based on sequence similarity using MMseqs2