Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 5.3e-22 7.7e-18 65.1 0.0 10 49 17 56 11 60 0.91

2 4 1.1 1.7e+04 -3.3 0.0 9 31 109 131 107 137 0.73

3 4 1.3 2e+04 -3.5 0.5 24 28 164 168 157 172 0.82

4 4 1.5 2.2e+04 -3.7 0.3 32 44 225 236 225 238 0.49

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	5.3e-22	7.7e-18	65.1	0.0	10	49	17	56	11	60	0.91
2	4	1.1	1.7e+04	-3.3	0.0	9	31	109	131	107	137	0.73
3	4	1.3	2e+04	-3.5	0.5	24	28	164	168	157	172	0.82
4	4	1.5	2.2e+04	-3.7	0.3	32	44	225	236	225	238	0.49

Coding Sequence: ATGTATTTGTGGCAAAAATCGAGACTGGTACTTCGAAAAGGCAAAGTCCCAAGCGATTGGAAGGATAAGTCAAGAACTTTATCAGATCAGCCGGCTACTTGTCCGTTGTGCGGCGCGATTATTCGCCAATCCCGAAATTTGCGACGTCATTTGGAACTATTGCATTTCGGAATTGGCTCCGGTAAATCTGGATTGCGTATGAAAAAAGACAAGGGGGAGAAGGGTTTAACCCCTAGGTCGCCCTCTTACTCTAGAGCCTCGTTAACGTTAAGGGATAGCGCGCATCATGCAAAGTCCAGCGCTACCGATTACTCGACGACAATGCCTCCTTCCCTAAACTTGAGCACCTCCGTCAGCTCTAGCGCATCTTCCGCTAACGTACCAGGTTCGTACTTGCTGGGAGGCTCGAgcgaccaccaccaccaccaccaccaccaccctgCCCACCACCACCACGGTCACAACAACACCCCCGCCCACCAGCTGCCCCCGGCCTCCTGTCCACCTTCCTCGATGGCGCCCCACAGCAACGGCATCTACTCGTCGGAGGGGGCGAGCATGCTCAGCTGTCTGCTACCGACGCTGCCCACGCTACCGGCCCTCTCCACGCCCCACGACATGTTCCGACACTCGGAATTCCTGCGCGCTGCGAACATGGGTTACCCGGACCCCGCAGTCGCGCGCCAGCAGCACGCCAGCCGACACCTGCAGCGCACTGACGTCACGTGA
Protein Sequence: MYLWQKSRLVLRKGKVPSDWKDKSRTLSDQPATCPLCGAIIRQSRNLRRHLELLHFGIGSGKSGLRMKKDKGEKGLTPRSPSYSRASLTLRDSAHHAKSSATDYSTTMPPSLNLSTSVSSSASSANVPGSYLLGGSSDHHHHHHHHPAHHHHGHNNTPAHQLPPASCPPSSMAPHSNGIYSSEGASMLSCLLPTLPTLPALSTPHDMFRHSEFLRAANMGYPDPAVARQQHASRHLQRTDVT

Sequence clustering based on sequence similarity using MMseqs2