Thel101722.1
Basic Information
- Insect
- Tipula helvola
- Gene Symbol
- Aef1
- Assembly
- GCA_963556165.1
- Location
- OY744483.1:142593559-142593933[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.00016 7.3 9.6 0.0 21 47 7 33 3 38 0.85 2 4 1.1e-05 0.51 13.3 0.0 21 50 35 64 29 66 0.87 3 4 0.00081 37 7.4 0.0 21 51 63 93 60 94 0.88 4 4 5.6e-05 2.6 11.1 0.1 21 46 91 116 89 121 0.91
Sequence Information
- Coding Sequence
- ATGAAGCTAACAAATGGCAGTGAAAAACCATTTGTATGCGATATATGTGAAAAACAATTTCGTCAATTGAGTACATTgacaaatcataaaaaaattcataccggcgaaaaaccatttaaatgtaatatatgtgaaaaatattttcgtcaaTCGTCCACGCTGACGAATCATGTGAAAATTCATACAGGTGAAAAACCATTTAATTGTACATTTTGTGGCAAACAATTTCGACAATTGAGTACATtaacaaatcatttaaaaatacatacggGCGAAAAACCGTTCGAGTGTGCCGTATGTAAAAAACAATTTCGCCAATCGAGCACACTAAATAATCACATAAAAATTCATGCTGGTGATAAACTTTATATGTGA
- Protein Sequence
- MKLTNGSEKPFVCDICEKQFRQLSTLTNHKKIHTGEKPFKCNICEKYFRQSSTLTNHVKIHTGEKPFNCTFCGKQFRQLSTLTNHLKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHAGDKLYM
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01164355;
- 90% Identity
- iTF_01164355;
- 80% Identity
- iTF_01052674;