Tcon023896.2
Basic Information
- Insect
- Tipula confusa
- Gene Symbol
- -
- Assembly
- GCA_963556175.1
- Location
- OY744476.1:143119504-143120092[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 5.4e-05 0.84 11.1 0.2 22 44 7 29 3 34 0.89 2 6 0.0092 1.4e+02 4.0 0.0 21 46 34 59 31 65 0.84 3 6 0.0018 28 6.3 0.0 21 44 62 85 60 93 0.86 4 6 0.00094 14 7.2 0.0 22 48 91 117 86 123 0.84 5 6 0.09 1.4e+03 0.8 0.1 21 45 118 142 115 149 0.80 6 6 0.0042 65 5.1 0.3 22 48 147 173 140 174 0.83
Sequence Information
- Coding Sequence
- ATGATAACCCATAACGAAAATAATCCACACAAATGtgaaatttgtggtaaaatataTCGTCAAGCAGCATCGCTTCGAAGTCACATGCTAACGCATACGGGTGAAAAACCATACTTGTGTGGTATATGCGGTAAAGGAATGACTCAAAAGAGTGGGTTCAAAAAGCATATGCTTATTCATACGGGCGAAAAACCTTTTCAATGTGATATTTGCGGTCGAGATTTTCGGTTCTCAAGTAATTTAATCATGCATAAGCGGTATCACACCGGCGATAAAccatttaattgcaaaatatgtGACAAACGTTTTCCGGGCAGTGAATCTCTCAAACGACATCTCCTTGTCCATACTGGCGAAAAACCGTATGCATGCGAATTTTGCGATCGGCGTTTTAATCGGCAAAATTCATTGCggattCATCGAAACATACATACTGGCGAAAAAAACTATGTGTGTCCCATCTGTGGGAAAGGTTATATTCAGCAACACTGTCTAACAGCACACACCAAACTAGCTCatcaataa
- Protein Sequence
- MITHNENNPHKCEICGKIYRQAASLRSHMLTHTGEKPYLCGICGKGMTQKSGFKKHMLIHTGEKPFQCDICGRDFRFSSNLIMHKRYHTGDKPFNCKICDKRFPGSESLKRHLLVHTGEKPYACEFCDRRFNRQNSLRIHRNIHTGEKNYVCPICGKGYIQQHCLTAHTKLAHQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -