Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 5.4e-05 0.84 11.1 0.2 22 44 7 29 3 34 0.89

2 6 0.0092 1.4e+02 4.0 0.0 21 46 34 59 31 65 0.84

3 6 0.0018 28 6.3 0.0 21 44 62 85 60 93 0.86

4 6 0.00094 14 7.2 0.0 22 48 91 117 86 123 0.84

5 6 0.09 1.4e+03 0.8 0.1 21 45 118 142 115 149 0.80

6 6 0.0042 65 5.1 0.3 22 48 147 173 140 174 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	5.4e-05	0.84	11.1	0.2	22	44	7	29	3	34	0.89
2	6	0.0092	1.4e+02	4.0	0.0	21	46	34	59	31	65	0.84
3	6	0.0018	28	6.3	0.0	21	44	62	85	60	93	0.86
4	6	0.00094	14	7.2	0.0	22	48	91	117	86	123	0.84
5	6	0.09	1.4e+03	0.8	0.1	21	45	118	142	115	149	0.80
6	6	0.0042	65	5.1	0.3	22	48	147	173	140	174	0.83

Coding Sequence: ATGATAACCCATAACGAAAATAATCCACACAAATGtgaaatttgtggtaaaatataTCGTCAAGCAGCATCGCTTCGAAGTCACATGCTAACGCATACGGGTGAAAAACCATACTTGTGTGGTATATGCGGTAAAGGAATGACTCAAAAGAGTGGGTTCAAAAAGCATATGCTTATTCATACGGGCGAAAAACCTTTTCAATGTGATATTTGCGGTCGAGATTTTCGGTTCTCAAGTAATTTAATCATGCATAAGCGGTATCACACCGGCGATAAAccatttaattgcaaaatatgtGACAAACGTTTTCCGGGCAGTGAATCTCTCAAACGACATCTCCTTGTCCATACTGGCGAAAAACCGTATGCATGCGAATTTTGCGATCGGCGTTTTAATCGGCAAAATTCATTGCggattCATCGAAACATACATACTGGCGAAAAAAACTATGTGTGTCCCATCTGTGGGAAAGGTTATATTCAGCAACACTGTCTAACAGCACACACCAAACTAGCTCatcaataa
Protein Sequence: MITHNENNPHKCEICGKIYRQAASLRSHMLTHTGEKPYLCGICGKGMTQKSGFKKHMLIHTGEKPFQCDICGRDFRFSSNLIMHKRYHTGDKPFNCKICDKRFPGSESLKRHLLVHTGEKPYACEFCDRRFNRQNSLRIHRNIHTGEKNYVCPICGKGYIQQHCLTAHTKLAHQ

Sequence clustering based on sequence similarity using MMseqs2