Tpel008416.1
Basic Information
- Insect
- Tinea pellionella
- Gene Symbol
- tfap2e_1
- Assembly
- GCA_948150575.1
- Location
- OX411268.1:3647339-3652619[-]
Transcription Factor Domain
- TF Family
- AP-2
- Domain
- TF_AP-2 domain
- PFAM
- PF03299
- TF Group
- Basic Domians group
- Description
- Activator protein-2 (AP-2) transcription factors constitute a family of closely related and evolutionarily conserved proteins that bind to the DNA consensus sequence GCCNNNGGC and stimulate target gene transcription [PMID: 2010091, PMID: 1998122]. Four different isoforms of AP-2 have been identified in mammals, termed AP-2 alpha, beta, gamma and delta. Each family member shares a common structure, possessing a proline/glutamine-rich domain in the N-terminal region, which is responsible for transcriptional activation [PMID: 2010091], and a helix-span-helix domain in the C-terminal region, which mediates dimerisation and site-specific DNA binding [PMID: 199812]. http://www.ebi.ac.uk/interpro/entry/IPR013854
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.5e-53 4.5e-49 167.0 0.0 46 196 17 164 15 165 0.96
Sequence Information
- Coding Sequence
- ATGTTGCTGCCAAATACTCCAAGAAAACATAGAATTGAGAAATATCTAGCGAAAAGCAAAAATGGCGGACGTTTATTAAGAGAAAAATTAGAAAAAATCGGCTTAAATCTTCCAGCTGGGAGACGGAAAGCTGCTAATGTTACTTTACTCACGTCTTTAGTTGAAGCTGAAGCTGTTCATTTAGCGAGAGATTTTGGTTATGTATGTGAAACAGAGTTCCCCGCGAGAGCATTAGCTGAATATCTAGCAAGACAATATGCCGAACATGATGCAAGACGCAGAAGAGATTTATTACAAGCTACGAAACAGGTCACAAAAGAACTCATGGATTTATTGAATCAAGATAGATCTCCTCTCTGCAACACGAGGCCACCACATTTATTAGAACCAGCAATACAGCGACATCTTACACACTTCTCATTAATTTCCCATGGGTTTGGTGGACCCGCCATTGTTGCAGCATTAACCGCTATTCAAAATTTCCTAAACGAGTCACTAAAGCATTTAGACAAATTATATCCACAATCGGGAATGGTCTCCTCGTCGATGGATAAAACGAAAATGGATCCAGATATTAAAAAGTAA
- Protein Sequence
- MLLPNTPRKHRIEKYLAKSKNGGRLLREKLEKIGLNLPAGRRKAANVTLLTSLVEAEAVHLARDFGYVCETEFPARALAEYLARQYAEHDARRRRDLLQATKQVTKELMDLLNQDRSPLCNTRPPHLLEPAIQRHLTHFSLISHGFGGPAIVAALTAIQNFLNESLKHLDKLYPQSGMVSSSMDKTKMDPDIKK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01362201;
- 90% Identity
- -
- 80% Identity
- -