Basic Information

Transcription Factor Domain

TF Family: TSC22
Domain: TSC22 domain
PFAM: PF01166
TF Group: Basic Domians group
Description: These proteins are highly similar in a region of about 50 residues that include a conserved leucine-zipper domain most probably involved in homo- or hetero-dimerisation. Drosophila protein bunched [1] (gene bun) (also known as shortsighted), a probable transcription factor required for peripheral nervous system morphogenesis, eye development and oogenesis.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.00024 6.5 9.1 0.0 8 41 10 44 6 48 0.67

2 4 0.00025 6.6 9.1 0.2 14 35 52 73 35 90 0.53

3 4 0.00036 9.7 8.5 0.1 11 43 63 95 61 103 0.73

4 4 0.00083 23 7.4 0.0 13 46 93 126 88 128 0.77

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.00024	6.5	9.1	0.0	8	41	10	44	6	48	0.67
2	4	0.00025	6.6	9.1	0.2	14	35	52	73	35	90	0.53
3	4	0.00036	9.7	8.5	0.1	11	43	63	95	61	103	0.73
4	4	0.00083	23	7.4	0.0	13	46	93	126	88	128	0.77

Coding Sequence: ATGTTTCGGAACACACTCAAGTGGTCTTTGTTCTACGCAGTACTACAGGAGTCTATAGCAGTACTACAGGAGACTATAGGAGTACTACAGGAGTCTATAGCAGCACTACAGGAGACTATAGGAGTACTACAGGAGACTATAGGAGTACTACAGGAGTCTATAGGAGTACTACAGGAGACTATAGCAGCACTACAGGAGACTATAGGAGTACTACAGGAGACTATAGGAGTACTACAGGAGACTATAGGAGTACTACAGGAGTCTATAGCAGTACTACAGGAGACTATAGGAGTACTACAGGAGACTATAGGAGTACTACAGGAGACTATAGGAGTACTACAGGAGACTATAGGAGTACTACAGGAGATCTATAGCAGTACTACAGGAGACTATAGCAGCACTACAGGAGACTATAGGAGTACTACAGGAGACTATAGGAGTACTACAGGAGTCTATAGCAGCACTACAGGAGACTATAGCAGTACTACAGGAGTCTATAGCAGTACTACAGGAGACTACAAGAATATACAGGGTCTATAG
Protein Sequence: MFRNTLKWSLFYAVLQESIAVLQETIGVLQESIAALQETIGVLQETIGVLQESIGVLQETIAALQETIGVLQETIGVLQETIGVLQESIAVLQETIGVLQETIGVLQETIGVLQETIGVLQEIYSSTTGDYSSTTGDYRSTTGDYRSTTGVYSSTTGDYSSTTGVYSSTTGDYKNIQGL*

Sequence clustering based on sequence similarity using MMseqs2