Tdou020500.1
Basic Information
- Insect
- Timema douglasi
- Gene Symbol
- -
- Assembly
- GCA_901482245.1
- Location
- CABEEJ010001800.1:112635-113255[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 0.084 2e+03 1.3 0.0 21 44 6 29 3 37 0.84 2 7 0.045 1e+03 2.2 0.0 21 44 34 57 30 65 0.85 3 7 0.067 1.5e+03 1.6 0.3 22 45 63 86 54 94 0.82 4 7 0.11 2.6e+03 0.9 0.0 22 44 91 113 86 117 0.85 5 7 0.0019 43 6.6 0.0 21 45 118 142 114 150 0.89 6 7 0.00081 19 7.8 0.0 26 45 151 170 148 177 0.90 7 7 0.0036 83 5.7 0.0 27 45 180 198 174 204 0.90
Sequence Information
- Coding Sequence
- ATGATATCACACAAGAACGATAAACCATTTGTTTGCTCGTACTGCGATTCTAAGTTCCGACGCAAAGAGCACCTGAAAGGGCACATGTTTACACATACAGGAGAGAAACCGTTCACGTGCGTGGAGTGCGGGTCTAAGTTCAGCCGGCGAGAGAACCTCAAGGTGCACGCACACAGCCACACGGGTGACAAGCCCTTCCAGTGTTCACAGTGCGGTCTGCGGTTCCGTTACCGGGCGAGCCTCAATCGACATCTTGTGACGCACAGCGGGGACAAACCCTACAAGTGCAACGCGTGTCCGTCAGCATTCACGCGCATGCAGAGCCTCAAGAAACATCTGTTGTCGCACACCAACGAGAAGCCTTGGTCTTGCTCGTTCTGTGACGCCAAGTTTAAAGACAAGAACGGTCTCGGCAGGCACTTGTTGATTCACACGGGACTGAAGAAGTACCAGTGTCCGCAATGCGAGGCCAAGTTTCAACAAGGCTCGCAACTCAAGAGACACATGACAACTCACACGGGACATAAATTGTTCGAGTGCCCCGTTTGCAAGGCAAAGTTTACACGCAACGGAAGTTTGAAAAAACATTTGCAGTCGCACGGGTCCACTAAGGTTATTTGa
- Protein Sequence
- MISHKNDKPFVCSYCDSKFRRKEHLKGHMFTHTGEKPFTCVECGSKFSRRENLKVHAHSHTGDKPFQCSQCGLRFRYRASLNRHLVTHSGDKPYKCNACPSAFTRMQSLKKHLLSHTNEKPWSCSFCDAKFKDKNGLGRHLLIHTGLKKYQCPQCEAKFQQGSQLKRHMTTHTGHKLFECPVCKAKFTRNGSLKKHLQSHGSTKVI*
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01447847;
- 90% Identity
- iTF_01447847;
- 80% Identity
- iTF_01446906;