Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.043 9.2e+02 2.3 0.0 21 46 6 31 3 37 0.83

2 7 0.05 1.1e+03 2.0 0.0 21 44 34 57 32 65 0.84

3 7 0.079 1.7e+03 1.4 0.2 22 45 63 86 57 93 0.82

4 7 0.1 2.3e+03 1.0 0.0 22 44 91 113 86 118 0.85

5 7 0.0019 40 6.6 0.0 21 45 118 142 114 150 0.89

6 7 0.00081 18 7.8 0.0 26 45 151 170 148 177 0.90

7 7 0.0027 58 6.1 0.0 26 45 179 198 173 204 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.043	9.2e+02	2.3	0.0	21	46	6	31	3	37	0.83
2	7	0.05	1.1e+03	2.0	0.0	21	44	34	57	32	65	0.84
3	7	0.079	1.7e+03	1.4	0.2	22	45	63	86	57	93	0.82
4	7	0.1	2.3e+03	1.0	0.0	22	44	91	113	86	118	0.85
5	7	0.0019	40	6.6	0.0	21	45	118	142	114	150	0.89
6	7	0.00081	18	7.8	0.0	26	45	151	170	148	177	0.90
7	7	0.0027	58	6.1	0.0	26	45	179	198	173	204	0.88

Coding Sequence: ATGATATCACATAAGAACGATAAACCGTTTGCCTGCTCGTACTGCGATTCTAAGTTCCGACGCAAAGAGCACCTGAAAGGACATATGTTTATACACACAGGAGAGAAACCGTTCACGTGCGTGGAGTGCGGGTCTAAGTTCAGCCGGCGAGAGAACCTCAAGGTGCACGCACACAGCCACACGGGTGACAAGCCCTTCCAGTGTTCACAGTGCGGTCTGCGGTTCCGTTACCGGGCAAGCCTCAATCGACATCTCGTGACGCACAGTGGGGACAAACCCTACAAGTGCAATGCGTGTCCATCAGCATTCACACGCATGCAGAGCCTCAAGAAACATCTCTTGTCGCACACCAATGAGAAGCCTTGGTCTTGCTCGTTCTGTGACGCTAAGTTCAAAGACAAGAACGGTCTCGGCAGGCACTTGTTGATTCACACGGGACTGAAGAAATACCAGTGTCCGCAATGTGAAGCCAAGTTTCAACAAGGCTCGCAACTCAAAAGACACATGACAACTCACACGGGACATAAACTGTTCGAGTGCCCCGTTTGCAAGGCAAAGTTTACACGCAACGGAAGTTTGAAAAAACATTTGCAGTCGCACGTGGCCACTAAGATTATTTga
Protein Sequence: MISHKNDKPFACSYCDSKFRRKEHLKGHMFIHTGEKPFTCVECGSKFSRRENLKVHAHSHTGDKPFQCSQCGLRFRYRASLNRHLVTHSGDKPYKCNACPSAFTRMQSLKKHLLSHTNEKPWSCSFCDAKFKDKNGLGRHLLIHTGLKKYQCPQCEAKFQQGSQLKRHMTTHTGHKLFECPVCKAKFTRNGSLKKHLQSHVATKII*

Sequence clustering based on sequence similarity using MMseqs2