Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0045 4.6 9.7 0.0 21 42 23 44 18 49 0.87

2 6 0.036 37 6.7 0.0 26 42 50 66 45 71 0.86

3 6 0.012 12 8.3 0.1 24 40 70 86 56 92 0.58

4 6 0.038 39 6.7 0.0 26 42 83 99 78 103 0.86

5 6 0.036 37 6.7 0.0 26 42 94 110 89 115 0.86

6 6 0.0078 8 8.9 0.0 24 44 114 134 108 146 0.81

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0045	4.6	9.7	0.0	21	42	23	44	18	49	0.87
2	6	0.036	37	6.7	0.0	26	42	50	66	45	71	0.86
3	6	0.012	12	8.3	0.1	24	40	70	86	56	92	0.58
4	6	0.038	39	6.7	0.0	26	42	83	99	78	103	0.86
5	6	0.036	37	6.7	0.0	26	42	94	110	89	115	0.86
6	6	0.0078	8	8.9	0.0	24	44	114	134	108	146	0.81

Coding Sequence: ATGTCAGGACCAAGTTGTTTCTGCTTGCCATGCAATCCTCTCAAGTCCCCTTACACTGATTCACGAGTCTCATTCCCTTTAATTAAGGCAGTCCTCACAGTTCGGTCACCAATATTCAAGGCAGTCCTCACAGTTCGGTCACCAATATTCAAGGCAGTCCTCACAGTTCGGTCACCAATATTCAAGGCAGTCCTCACAGTTCGGTCACCAATATTCAAGGCAGTCCTCACAGTTCGGTCACCAATATTCAAGGCAGTCCTCACAGTTCGGTCACCAATATTCAAGGCAGTCCTCACAGTTCGGTCACCAATATTCAAGGCAGTCCTCACAGTTCGGTCACCAATATTCAAGGCAGTCCTCACAGTTCGGTCACCAATATTCAAGGCAGTCCTCACAGACTCTCTTTCTTTGTCCAAGAATTGGAAGGTAGTAGGCACGATTGTCTTTTCTAGTTGA
Protein Sequence: MSGPSCFCLPCNPLKSPYTDSRVSFPLIKAVLTVRSPIFKAVLTVRSPIFKAVLTVRSPIFKAVLTVRSPIFKAVLTVRSPIFKAVLTVRSPIFKAVLTVRSPIFKAVLTVRSPIFKAVLTVRSPIFKAVLTDSLSLSKNWKVVGTIVFSS*

Sequence clustering based on sequence similarity using MMseqs2