Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.1 19 5.2 0.1 21 49 27 55 21 58 0.86

2 8 0.027 4.9 7.0 0.0 21 47 55 81 47 87 0.81

3 8 0.3 55 3.7 0.0 22 46 84 108 79 114 0.85

4 8 0.6 1.1e+02 2.7 0.0 23 46 113 136 109 142 0.85

5 8 0.28 51 3.8 0.0 22 46 140 164 135 170 0.84

6 8 0.14 25 4.8 0.0 22 47 168 193 163 199 0.84

7 8 0.059 11 5.9 0.0 22 45 196 219 191 227 0.89

8 8 0.8 1.5e+02 2.3 0.4 26 45 228 247 219 250 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.1	19	5.2	0.1	21	49	27	55	21	58	0.86
2	8	0.027	4.9	7.0	0.0	21	47	55	81	47	87	0.81
3	8	0.3	55	3.7	0.0	22	46	84	108	79	114	0.85
4	8	0.6	1.1e+02	2.7	0.0	23	46	113	136	109	142	0.85
5	8	0.28	51	3.8	0.0	22	46	140	164	135	170	0.84
6	8	0.14	25	4.8	0.0	22	47	168	193	163	199	0.84
7	8	0.059	11	5.9	0.0	22	45	196	219	191	227	0.89
8	8	0.8	1.5e+02	2.3	0.4	26	45	228	247	219	250	0.86

Coding Sequence: ATGGGTCACGACTGTCCAGTGTGCGGCAAGAAGAATAAGTGGGCGTCCAGTCTGACTGTGCACCTGCGGACCCACACgggggagaagccttttgagtgcacggtttgcaacaagaagttcagccAACGTAGCCAGCTCAAACCGCACCTCCGAATCCACACAGGAGAGAAGCCCTTCGAGTGTaaggtttgcaacaagaagttcaccGAAAGTGCCAGCCTCAGAGTGCATCTCCGGACCCACACTGGGGAcaagccctttgagtgcacggTCTGCAACAAGAGGTTCAGCGAAGGTGGCGACCTCAGAAAGCATCTCCGGACCCACACAGGATAcaagccctttgagtgcacggTTTGCAACAAAAAGTTCATCGAAAGTGGCAAGCTCAGAGTGCATCTCCGGACCCACACAGGAGAcaagccctttgagtgcacggTCTGCAATAAGAGGTTCCTCCATGGTGGCAATCTCAGAGTGCATCTCCGGACCCACACAGGGGACAAGCCCTTTGAGTGTACGGTCTGCAATACGAGGTTCCTCCATGGCGGCAATCTCAGAGTGCATCTCCGGACCCACACAGGAGACaagccttttgagtgcacGGTTTGCAACGAGAAGTTCAGCCAAGGTGGTAGCCTCAGAAAGCATCTCCGGGCCCACACAGAAGACAAGCGCTTTGAGTGCGCGGTTTGCAGCAAGAGGTTCCGGCAAATTTCTCATCTGAAAACGCACCTGCGAACCCACACTGAAGGACACGATTTGAACATCCAGTTGGCTAATGGAAGTTAA
Protein Sequence: MGHDCPVCGKKNKWASSLTVHLRTHTGEKPFECTVCNKKFSQRSQLKPHLRIHTGEKPFECKVCNKKFTESASLRVHLRTHTGDKPFECTVCNKRFSEGGDLRKHLRTHTGYKPFECTVCNKKFIESGKLRVHLRTHTGDKPFECTVCNKRFLHGGNLRVHLRTHTGDKPFECTVCNTRFLHGGNLRVHLRTHTGDKPFECTVCNEKFSQGGSLRKHLRAHTEDKRFECAVCSKRFRQISHLKTHLRTHTEGHDLNIQLANGS

Sequence clustering based on sequence similarity using MMseqs2