Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.0064 1.2 9.0 0.0 21 47 27 53 19 60 0.84

2 8 9 1.7e+03 -1.1 0.2 21 32 55 66 51 81 0.72

3 8 0.0085 1.6 8.6 0.1 19 48 81 110 73 114 0.80

4 8 0.041 7.5 6.4 0.0 21 52 111 142 107 143 0.87

5 8 1.5 2.7e+02 1.5 0.0 21 46 139 164 136 171 0.80

6 8 4.7 8.6e+02 -0.2 0.1 21 33 167 179 149 194 0.78

7 8 0.32 59 3.6 0.0 21 45 195 219 187 226 0.82

8 8 0.7 1.3e+02 2.5 0.0 20 41 222 243 215 247 0.79

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.0064	1.2	9.0	0.0	21	47	27	53	19	60	0.84
2	8	9	1.7e+03	-1.1	0.2	21	32	55	66	51	81	0.72
3	8	0.0085	1.6	8.6	0.1	19	48	81	110	73	114	0.80
4	8	0.041	7.5	6.4	0.0	21	52	111	142	107	143	0.87
5	8	1.5	2.7e+02	1.5	0.0	21	46	139	164	136	171	0.80
6	8	4.7	8.6e+02	-0.2	0.1	21	33	167	179	149	194	0.78
7	8	0.32	59	3.6	0.0	21	45	195	219	187	226	0.82
8	8	0.7	1.3e+02	2.5	0.0	20	41	222	243	215	247	0.79

Coding Sequence: ATGCCGTTTGAATGTAGTTATTGTTCGAAGACGTGGCCCAGCGCATTTGCCCTGAAGACACACTTTCGAACTCACACGGGGGAAAAGCCATTTGAGTGTCCAGTTTGCAAGAAAAAGTTCAGTCAATCTAGCAGCATAGGAACGCACCTTCGCACGCATACAAGGGAAAAGCCGTTTGAGTGCACTGTTTGCAAAAGAAAGTTCTCCACGAATTGTTCGCTCAAAAGTCACCATTCTATCCACAGAGAAGAAAGGCCATTCACGTGCGCAGTTTGTAAGTTTGCCTTCAAGCGGTATAGTGACCTCAAGTTGCACCTTCGTATCCATACTGGCGAAAAGCCGTATGAGTGTTCACTTTGTGAGAAAAAGTTTAGCTCAAGTGGCAACCTTGATAAGCACCTCGTTGTTCACAAAGGGGAGAAGCCATTCCAGTGTACAGTTTGTTCAAAGAAATTTGGACGCGGAGAACACCTTAAAGTGCACCTCCGTACCcatacaggggagaagccGTATGAGTGCTCGGTTTGCAATAAAAGGTTTACGACAAGTTCGATACTTTATTCGCACCAGCGCACTCATTCAGGAGAAAAACCATTTGCATGTTCCGCTTGTGAGGTGAAGTTTGTTTCATCGAGTGACCTGAAGAAGCACTTTCGCTCTCATACGGGAGAAAAACCATTTGAGTGTGCGGTTTGTAAAAAGAGGTTTAGTACAAGTGGGAACCTAAAAAATTCACATTCGTATTCATACTGGTGA
Protein Sequence: MPFECSYCSKTWPSAFALKTHFRTHTGEKPFECPVCKKKFSQSSSIGTHLRTHTREKPFECTVCKRKFSTNCSLKSHHSIHREERPFTCAVCKFAFKRYSDLKLHLRIHTGEKPYECSLCEKKFSSSGNLDKHLVVHKGEKPFQCTVCSKKFGRGEHLKVHLRTHTGEKPYECSVCNKRFTTSSILYSHQRTHSGEKPFACSACEVKFVSSSDLKKHFRSHTGEKPFECAVCKKRFSTSGNLKNSHSYSYW

Sequence clustering based on sequence similarity using MMseqs2