Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.37 68 3.4 0.1 21 48 27 54 21 58 0.85

2 9 0.15 27 4.7 0.0 21 47 55 81 52 87 0.86

3 9 0.1 18 5.2 0.0 22 46 112 136 102 142 0.85

4 9 0.35 63 3.5 0.0 22 47 140 165 135 171 0.84

5 9 1.7 3.1e+02 1.2 0.0 22 45 168 191 163 194 0.88

6 9 0.069 13 5.7 0.0 21 47 195 221 191 227 0.86

7 9 0.27 50 3.8 0.0 22 46 224 248 219 254 0.84

8 9 0.079 14 5.5 0.0 22 45 252 275 247 282 0.89

9 9 1 1.9e+02 2.0 0.5 26 45 284 303 275 307 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.37	68	3.4	0.1	21	48	27	54	21	58	0.85
2	9	0.15	27	4.7	0.0	21	47	55	81	52	87	0.86
3	9	0.1	18	5.2	0.0	22	46	112	136	102	142	0.85
4	9	0.35	63	3.5	0.0	22	47	140	165	135	171	0.84
5	9	1.7	3.1e+02	1.2	0.0	22	45	168	191	163	194	0.88
6	9	0.069	13	5.7	0.0	21	47	195	221	191	227	0.86
7	9	0.27	50	3.8	0.0	22	46	224	248	219	254	0.84
8	9	0.079	14	5.5	0.0	22	45	252	275	247	282	0.89
9	9	1	1.9e+02	2.0	0.5	26	45	284	303	275	307	0.86

Coding Sequence: ATGGGTCACGACTGTCCAGTGTGCGGCAAGAAGAATGAGTCCGCGTCCAAGCTGACTGTGCACCTGCGGACCCACACGGGAGAGAAGCCATTTGAGTGcacggtttgcaacaagaagttcagccATCGTTGCAACCTCAAAACGCACGTCAGGATCCACACAGGAGAGAAGCCATTGGAGTGcacggtttgcaacaagaaatTCAGCGAAGGTGGCAGCCTCAGAAAGCATCTCCGGACCCACACAGGAGAcaagccctttgagtgcacggTTTGGAACAAGAAATTCAGCCAAGGTAGTAGCTTCAGAAAGCATTTCCGGACCCACACAGGGGACaagccttttgagtgcacggtctgcaacaagaagttcactGAAAGTGGCAGCCTCAGAAATCATCTCCGGACCCACACAGGGGACaagccttttgagtgcacggtttgcaacaagaagttcatcGATAGTGTCAAGCTCAGAGTACACCTCCGGACCCACACAGGGGAcaagccctttgagtgcacggcctgcaacaagaagttcaccACAAGTGGCAGCCTCAGAATGCATCTTCGGACCCACACAGGAGAAAGGCCCTTACAGTGcacggtttgcaacaagaagttcacgGCAAGTGGCAGCCTCAGAATGCATCTCCGGACGCACACAGGGGACAAGCCCTTTAAGTGcacggtttgcaacaagaagttcctCCATGGTGGCAATCTCAGAGTGCATCTCCGGACGCACACAGGAGACaagccttttgagtgcacGGTTTGCAACGAGAAGTTCAGCCAAGGTGGCAGCCTCAGAAAGCATCTCCGGGCCCACACAGAAGACAAGCGCTTTGAGTGCGCGGTTTGCAGCAAGAGGTTCCGGCAAATTTCTCATCTGAAAACGCACCTGCGAACTCACACTCAAGGACACGATTTGAACATCCAGTCGGCAAACGGGAGTTAA
Protein Sequence: MGHDCPVCGKKNESASKLTVHLRTHTGEKPFECTVCNKKFSHRCNLKTHVRIHTGEKPLECTVCNKKFSEGGSLRKHLRTHTGDKPFECTVWNKKFSQGSSFRKHFRTHTGDKPFECTVCNKKFTESGSLRNHLRTHTGDKPFECTVCNKKFIDSVKLRVHLRTHTGDKPFECTACNKKFTTSGSLRMHLRTHTGERPLQCTVCNKKFTASGSLRMHLRTHTGDKPFKCTVCNKKFLHGGNLRVHLRTHTGDKPFECTVCNEKFSQGGSLRKHLRAHTEDKRFECAVCSKRFRQISHLKTHLRTHTQGHDLNIQSANGS

Sequence clustering based on sequence similarity using MMseqs2