Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.048 8.7 6.2 0.0 21 48 27 54 19 58 0.86

2 6 0.1 19 5.1 0.0 21 46 55 80 51 86 0.86

3 6 0.15 28 4.6 0.0 22 44 84 106 79 110 0.90

4 6 0.091 17 5.3 0.0 22 46 112 136 107 142 0.86

5 6 0.24 44 4.0 0.0 22 47 140 165 135 171 0.84

6 6 0.22 41 4.1 0.0 22 45 168 191 163 199 0.88

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.048	8.7	6.2	21	48	27	54	19	58	0.86
2	6	0.1	19	5.1	21	46	55	80	51	86	0.86
3	6	0.15	28	4.6	22	44	84	106	79	110	0.90
4	6	0.091	17	5.3	22	46	112	136	107	142	0.86
5	6	0.24	44	4.0	22	47	140	165	135	171	0.84
6	6	0.22	41	4.1	22	45	168	191	163	199	0.88

Coding Sequence: ATGGGTCACGACTGTCCAGTGTGCGGCAAGAAGAATGAGTCCGCGTCCAAGCTGACTGTGCACCTGCGGACCCACACGGGAGAGAAGCCATTTGAGTGcacggtttgcaacaagaagttcagccAACGTAGCAACCTCACAACGCACGTCAGGATCCACACAGGAGAGAAGCCATTGGAGTGcacggtttgcaacaagaaatTCAGCGAAGGTGGCAGCCTCAGAAAGCATCTCCGGACCCACACAGGAGAcaagccctttgagtgcacggtttgcaacaagaaatTCAGCCAAGGTAGTAGCCTCAGAAAGCATTTCCGGACCCTCACAGGGGACaagccttttgagtgcacggtctgcaacaagaagttcactGAAAGTGGCAGCCTCAGAAATCATCTCCGGACCCACACAGGGGACaagccttttgagtgcacggtttgcaacaagaagttcatcGATAGTGTCAAGCTCAGAGTACACCTCCGGACCCACACAGGGGAcaagccctttgagtgcacggtctgcaacaagaagttcaccACAAGTGGCAGCCTCAGAATGCATCTTCGGACCCACACAGGAGAAAGGCCCTTTCagtgtacacttgtacggtttgcaacaagaagttcactGAAAGTGGCAGCCTCAGAAATCATCTCCGGACCCACACAGGGGACAACCCTATTGAGTGcacggtttgcaacaagaagttcatcCAAGGTGGCAGCCTAA
Protein Sequence: MGHDCPVCGKKNESASKLTVHLRTHTGEKPFECTVCNKKFSQRSNLTTHVRIHTGEKPLECTVCNKKFSEGGSLRKHLRTHTGDKPFECTVCNKKFSQGSSLRKHFRTLTGDKPFECTVCNKKFTESGSLRNHLRTHTGDKPFECTVCNKKFIDSVKLRVHLRTHTGDKPFECTVCNKKFTTSGSLRMHLRTHTGERPFQCTLVRFATRSSLKVAASEIISGPTQGTTLLSARFATRSSSKVAA

Sequence clustering based on sequence similarity using MMseqs2