Tpal006670.1
Basic Information
- Insect
- Thrips palmi
- Gene Symbol
- -
- Assembly
- GCA_012932325.1
- Location
- NW:1371860-1375438[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.67 1.2e+02 2.5 0.1 27 44 8 25 4 32 0.87 2 4 0.0018 0.32 10.8 0.0 21 51 58 88 35 89 0.88 3 4 0.073 13 5.6 0.0 21 43 86 108 84 114 0.91 4 4 0.0021 0.38 10.6 0.0 21 45 114 138 106 142 0.87
Sequence Information
- Coding Sequence
- ATGGCTGGAAACACCTTTGATTGCGAAGTTTGCAGTAAAGTCTTTCAACACCAAAGCAGTCTCACAAGGCACATTCTAACCCATCGGGGAGTGAAGCTTTTCCATTGCTCATCCTGCACAAAGAAGTTCAGCGACAGTCAGAGTTTGGCCGCCCACCATCGAACGCACACTGGTGAAGAACCATTCAAGTGTGACAGTTGCAAGAAAACGTTCAGTGACTCCAGCAATCTTAGAAAGCATGTGAGGATTCATACGAAGGAAAAACCCTTTTCTTGCCAAACTTGCAAACGTAAGTTCAGCCAAGGAAGCAACCTGAAAAAACACgagcgcacgcacactggggagaagccttttcAATGTTCAATTTGCAAGATGAAATTCAGCCAAAAAGGCAACATAAAGAAGCACCTTCGTACTCATTCACAGGAAGAGGTAGATAGTGAGGGTTATGATGACTAA
- Protein Sequence
- MAGNTFDCEVCSKVFQHQSSLTRHILTHRGVKLFHCSSCTKKFSDSQSLAAHHRTHTGEEPFKCDSCKKTFSDSSNLRKHVRIHTKEKPFSCQTCKRKFSQGSNLKKHERTHTGEKPFQCSICKMKFSQKGNIKKHLRTHSQEEVDSEGYDD
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01435431;
- 90% Identity
- iTF_01435431;
- 80% Identity
- iTF_01435431;