Tpal008014.1
Basic Information
- Insect
- Thrips palmi
- Gene Symbol
- -
- Assembly
- GCA_012932325.1
- Location
- NW:10674367-10678342[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.0044 0.81 9.5 0.1 21 46 29 54 23 59 0.90 2 5 0.21 38 4.2 0.0 20 46 84 110 73 116 0.76 3 5 0.011 2 8.3 0.0 21 45 113 137 109 144 0.86 4 5 0.96 1.8e+02 2.0 0.0 22 45 142 165 138 169 0.87 5 5 0.0045 0.82 9.5 0.0 21 45 169 193 165 196 0.91
Sequence Information
- Coding Sequence
- atgaaaataagTCGCGACTGTCCAGTGTGCGGTAGGAAAAATGAGTCCGTGTCCAAGCTGACGATGCATCTCCGGACCCACACGggagagaagccttttgagtgcacGGTTTGTAACAAGAAGTTCAGCCAACGTAGCCACCTCAAAAGGCACCTCCAGATCCATACAGGAGAGAAGCTCTTCGAGTGCatggtttgcaacaagaagttcggGGAAGGTGGCGGCCTTAGAGCGCACATTCGGTCGCACACAGGAGAGAAACCATTTGAGTGcacggtttgcaacaagaagttcatcCGTGGTCCCACCCTCAGAGTGCACCTCCGGACCCACACAGGAGAGAAGCCATGGGAGTGCACGGACTGCAACAAGAAATTTACTCAAAACAGCGATCTTAGAAGACACCTCCTAACCCACACAGGAGAcaagccctttgagtgcacggtctgcaacaagaagttcaacCGTGGTTCCACCCTCAGAGTGCACCTTCGGACCCACACAGGAGAGaagccctttgagtgcacggtttgcaacaagaagttcaccCAAGGTGGCAACCTCAGAGTGCACCTTCGCACCCACACAGGCGACACATCCCTTTAA
- Protein Sequence
- MKISRDCPVCGRKNESVSKLTMHLRTHTGEKPFECTVCNKKFSQRSHLKRHLQIHTGEKLFECMVCNKKFGEGGGLRAHIRSHTGEKPFECTVCNKKFIRGPTLRVHLRTHTGEKPWECTDCNKKFTQNSDLRRHLLTHTGDKPFECTVCNKKFNRGSTLRVHLRTHTGEKPFECTVCNKKFTQGGNLRVHLRTHTGDTSL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01435341; iTF_01435182;
- 90% Identity
- iTF_01435341; iTF_01435182;
- 80% Identity
- iTF_01435341; iTF_01435182;