Tpal011265.1
Basic Information
- Insect
- Thrips palmi
- Gene Symbol
- -
- Assembly
- GCA_012932325.1
- Location
- NW:1037295-1048890[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 9 0.2 37 4.2 0.1 21 49 27 55 21 58 0.86 2 9 0.037 6.7 6.6 0.0 21 47 55 81 47 87 0.81 3 9 1.8 3.3e+02 1.2 0.0 22 46 84 108 79 114 0.79 4 9 0.0026 0.47 10.3 0.0 22 52 112 142 103 143 0.87 5 9 0.32 58 3.6 0.0 22 44 140 162 137 167 0.89 6 9 0.043 7.8 6.4 0.0 21 46 167 192 164 198 0.86 7 9 0.15 27 4.7 0.0 22 47 196 221 191 227 0.85 8 9 0.028 5.1 7.0 0.0 22 52 224 254 219 255 0.86 9 9 0.52 96 2.9 0.3 22 45 252 275 247 278 0.89
Sequence Information
- Coding Sequence
- ATGGGTCACGACTGTCCAGTTTGCGGCAAAAAGAATGAGTTCGCGTCCAAGCTGGTTGTGCACCTGCGGACCCACACgggggagaagccttttgagtgcagggtttgcaacaagaagttcagccAACGTAGCCAGCTCAAACCGCACCTCCGAATCCACACAGGAGAGAAGCCCTTCGAGTGCaaggtttgcaacaagaagttcacgGAAAGTGCCAGCCTCAGAGTGCATCTCCGGACCCACACTGGGGAcaagccctttgagtgcacggtttgcaacaagaagttcatcCGTGGTGGCGACCTTAGAGTGCATCTCCGGACCCACACTGGGGACAAGCCCTTTAAGTGCACGGTTTGCTACAAGAAGTTCGCCGAAAGTGGCAGCCTCAGAGTGCATCTGCGGATCCACACAGGAGAcaagccctttgagtgcacggtctgcaacaagaagttcaccATAAGTGGCAGCCTCAGAAAGCATCTCCTGACTCACACAGGAGAAAGGCCCTTTAAGTGcacggtttgcaacaagaagttcatcCAAGGTAGCGAACTCAGAGAGCATCTCCGGACCCACACAGGAGAcaagccctttgagtgcacggtctgcaacaagaagttcaccAGAAGTGGCAGCCTAAGAATGCATCTCCGGACCCACACAGGAGACAAGCCCTTCGAGTGCACGGTTTGCAGCAAGAAGTTCACCGAAAGTGGCCATCTCAGAAAGCATCTCCGGATCCACACAGGAGAcaagccctttgagtgcacggTTTGCAGCAAGAGGTTCTGCCAAAACTctcatctgaaaaagcatctGCGAACCCACACTGGAGGACACGATTTGAACATCCAGTTGGCAAATGGGAGTTTAGTCATCTTGCAAGATGACAGCAGTCTCAACTGCGCATTCTCGTTGAGGAAAAACGGTAGGCTGAATTTTTCGGAAGACGATTACTTAAGCGGCAGGCGTAAGTGTACCGGTTGA
- Protein Sequence
- MGHDCPVCGKKNEFASKLVVHLRTHTGEKPFECRVCNKKFSQRSQLKPHLRIHTGEKPFECKVCNKKFTESASLRVHLRTHTGDKPFECTVCNKKFIRGGDLRVHLRTHTGDKPFKCTVCYKKFAESGSLRVHLRIHTGDKPFECTVCNKKFTISGSLRKHLLTHTGERPFKCTVCNKKFIQGSELREHLRTHTGDKPFECTVCNKKFTRSGSLRMHLRTHTGDKPFECTVCSKKFTESGHLRKHLRIHTGDKPFECTVCSKRFCQNSHLKKHLRTHTGGHDLNIQLANGSLVILQDDSSLNCAFSLRKNGRLNFSEDDYLSGRRKCTG
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01435253;
- 90% Identity
- iTF_01435253;
- 80% Identity
- iTF_01435253;