Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.2 37 4.2 0.1 21 49 27 55 21 58 0.86

2 9 0.037 6.7 6.6 0.0 21 47 55 81 47 87 0.81

3 9 1.8 3.3e+02 1.2 0.0 22 46 84 108 79 114 0.79

4 9 0.0026 0.47 10.3 0.0 22 52 112 142 103 143 0.87

5 9 0.32 58 3.6 0.0 22 44 140 162 137 167 0.89

6 9 0.043 7.8 6.4 0.0 21 46 167 192 164 198 0.86

7 9 0.15 27 4.7 0.0 22 47 196 221 191 227 0.85

8 9 0.028 5.1 7.0 0.0 22 52 224 254 219 255 0.86

9 9 0.52 96 2.9 0.3 22 45 252 275 247 278 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.2	37	4.2	0.1	21	49	27	55	21	58	0.86
2	9	0.037	6.7	6.6	0.0	21	47	55	81	47	87	0.81
3	9	1.8	3.3e+02	1.2	0.0	22	46	84	108	79	114	0.79
4	9	0.0026	0.47	10.3	0.0	22	52	112	142	103	143	0.87
5	9	0.32	58	3.6	0.0	22	44	140	162	137	167	0.89
6	9	0.043	7.8	6.4	0.0	21	46	167	192	164	198	0.86
7	9	0.15	27	4.7	0.0	22	47	196	221	191	227	0.85
8	9	0.028	5.1	7.0	0.0	22	52	224	254	219	255	0.86
9	9	0.52	96	2.9	0.3	22	45	252	275	247	278	0.89

Coding Sequence: ATGGGTCACGACTGTCCAGTTTGCGGCAAAAAGAATGAGTTCGCGTCCAAGCTGGTTGTGCACCTGCGGACCCACACgggggagaagccttttgagtgcagggtttgcaacaagaagttcagccAACGTAGCCAGCTCAAACCGCACCTCCGAATCCACACAGGAGAGAAGCCCTTCGAGTGCaaggtttgcaacaagaagttcacgGAAAGTGCCAGCCTCAGAGTGCATCTCCGGACCCACACTGGGGAcaagccctttgagtgcacggtttgcaacaagaagttcatcCGTGGTGGCGACCTTAGAGTGCATCTCCGGACCCACACTGGGGACAAGCCCTTTAAGTGCACGGTTTGCTACAAGAAGTTCGCCGAAAGTGGCAGCCTCAGAGTGCATCTGCGGATCCACACAGGAGAcaagccctttgagtgcacggtctgcaacaagaagttcaccATAAGTGGCAGCCTCAGAAAGCATCTCCTGACTCACACAGGAGAAAGGCCCTTTAAGTGcacggtttgcaacaagaagttcatcCAAGGTAGCGAACTCAGAGAGCATCTCCGGACCCACACAGGAGAcaagccctttgagtgcacggtctgcaacaagaagttcaccAGAAGTGGCAGCCTAAGAATGCATCTCCGGACCCACACAGGAGACAAGCCCTTCGAGTGCACGGTTTGCAGCAAGAAGTTCACCGAAAGTGGCCATCTCAGAAAGCATCTCCGGATCCACACAGGAGAcaagccctttgagtgcacggTTTGCAGCAAGAGGTTCTGCCAAAACTctcatctgaaaaagcatctGCGAACCCACACTGGAGGACACGATTTGAACATCCAGTTGGCAAATGGGAGTTTAGTCATCTTGCAAGATGACAGCAGTCTCAACTGCGCATTCTCGTTGAGGAAAAACGGTAGGCTGAATTTTTCGGAAGACGATTACTTAAGCGGCAGGCGTAAGTGTACCGGTTGA
Protein Sequence: MGHDCPVCGKKNEFASKLVVHLRTHTGEKPFECRVCNKKFSQRSQLKPHLRIHTGEKPFECKVCNKKFTESASLRVHLRTHTGDKPFECTVCNKKFIRGGDLRVHLRTHTGDKPFKCTVCYKKFAESGSLRVHLRIHTGDKPFECTVCNKKFTISGSLRKHLLTHTGERPFKCTVCNKKFIQGSELREHLRTHTGDKPFECTVCNKKFTRSGSLRMHLRTHTGDKPFECTVCSKKFTESGHLRKHLRIHTGDKPFECTVCSKRFCQNSHLKKHLRTHTGGHDLNIQLANGSLVILQDDSSLNCAFSLRKNGRLNFSEDDYLSGRRKCTG

Sequence clustering based on sequence similarity using MMseqs2