Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.68 1.2e+02 2.5 0.1 22 46 28 52 20 58 0.87

2 10 4.3 7.8e+02 -0.0 0.0 26 47 60 81 51 87 0.78

3 10 0.72 1.3e+02 2.4 0.0 21 45 83 107 76 113 0.87

4 10 0.35 64 3.4 0.1 22 45 112 135 107 141 0.85

5 10 0.27 50 3.8 0.1 25 45 143 163 135 169 0.86

6 10 1.9 3.4e+02 1.1 0.1 22 45 168 191 163 194 0.84

7 10 0.003 0.54 10.1 0.1 21 45 195 219 191 222 0.91

8 10 0.035 6.4 6.6 0.0 21 47 223 249 219 256 0.86

9 10 0.98 1.8e+02 2.0 0.0 22 46 252 276 247 282 0.83

10 10 0.0042 0.76 9.6 0.1 22 44 280 302 276 309 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.68	1.2e+02	2.5	0.1	22	46	28	52	20	58	0.87
2	10	4.3	7.8e+02	-0.0	0.0	26	47	60	81	51	87	0.78
3	10	0.72	1.3e+02	2.4	0.0	21	45	83	107	76	113	0.87
4	10	0.35	64	3.4	0.1	22	45	112	135	107	141	0.85
5	10	0.27	50	3.8	0.1	25	45	143	163	135	169	0.86
6	10	1.9	3.4e+02	1.1	0.1	22	45	168	191	163	194	0.84
7	10	0.003	0.54	10.1	0.1	21	45	195	219	191	222	0.91
8	10	0.035	6.4	6.6	0.0	21	47	223	249	219	256	0.86
9	10	0.98	1.8e+02	2.0	0.0	22	46	252	276	247	282	0.83
10	10	0.0042	0.76	9.6	0.1	22	44	280	302	276	309	0.88

Coding Sequence: ATGGGTCACGACTGTCCAGTGTGCggtaaaaaaaataagtcCGTGTCAAAGCTGACGGTACATCTCCGGACCCACACGGGACagaagccttttgagtgcacggtttgcaacaagaGGTTCAGCCAACGTGGCCACCTAAAAACGCACCTCCAGATCCATACAGGAGAGAAGCTCTTTGAGTGCatggtttgcaacaagaagttcgcCGAAGGTGGCCACCTGAGAAAGCATCTACGGACCCACACAGGAGAGAAACCAtttgagtgcacagtttgcaacaagaagttcgcCGAAGGTGGCCACCTCAGAATGCACCTACGGACTCACACAGGAGAGAAACGATTTGAATGTACGGTTTGTAACAAGAAATTTATTCAGAACAGCGATCTTCAAAGACACCTCCGGACCCACACAGGCGAGAAGTTTTTTGAGTGCACgatttgcaacaagaagttcagccGGGGCGAAAACCTCAGAGTGCACCTTCGGACTCACACAGGAGAGAAGACATTTGAGTGCACGGTCTGCAACCAGAAGTTCATCCATGGTGGCAACCTCAGAGTGCACCTCCGAACCCACACAGGCGACCagccctttgagtgcacggtatgcaacaagaagtttagCCAAAGTACACACCTCACAAGACACCTCCGAACCCACACAGGTGACCagccctttgagtgcacggtatgcaacaagaagtttagCCAAAGTGGACACCTCACAACACACCTCCGAACCCACACAGACGACaagccttttgagtgcactgtttgcaacaagaagtttaaCCATGGTGGGCAGCTCAGAACGCATCTGAGGACCCACACAGGAGACAAGCCCTTCGAGTGCATGGTTTGCAGCAAGATGTTCAGGCAAAGCTCTCATCTGAGAACGCATTCGCGAACCCACATGAGAAAGGCTTTGAATGTCGAGTTTGCAGATGGAATAAGAGAGCAGTCTCACTAG
Protein Sequence: MGHDCPVCGKKNKSVSKLTVHLRTHTGQKPFECTVCNKRFSQRGHLKTHLQIHTGEKLFECMVCNKKFAEGGHLRKHLRTHTGEKPFECTVCNKKFAEGGHLRMHLRTHTGEKRFECTVCNKKFIQNSDLQRHLRTHTGEKFFECTICNKKFSRGENLRVHLRTHTGEKTFECTVCNQKFIHGGNLRVHLRTHTGDQPFECTVCNKKFSQSTHLTRHLRTHTGDQPFECTVCNKKFSQSGHLTTHLRTHTDDKPFECTVCNKKFNHGGQLRTHLRTHTGDKPFECMVCSKMFRQSSHLRTHSRTHMRKALNVEFADGIREQSH

Sequence clustering based on sequence similarity using MMseqs2