Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.13 24 4.8 0.2 24 45 2 23 1 30 0.84

2 7 0.15 28 4.6 0.2 21 43 27 49 23 56 0.85

3 7 0.1 19 5.2 0.0 11 45 43 79 38 83 0.78

4 7 0.021 3.9 7.3 0.0 21 45 83 107 79 114 0.86

5 7 0.73 1.3e+02 2.4 0.1 21 45 111 135 108 139 0.86

6 7 0.0037 0.68 9.8 0.0 21 51 139 169 135 170 0.87

7 7 0.013 2.3 8.1 0.0 21 47 167 192 165 198 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.13	24	4.8	0.2	24	45	2	23	1	30	0.84
2	7	0.15	28	4.6	0.2	21	43	27	49	23	56	0.85
3	7	0.1	19	5.2	0.0	11	45	43	79	38	83	0.78
4	7	0.021	3.9	7.3	0.0	21	45	83	107	79	114	0.86
5	7	0.73	1.3e+02	2.4	0.1	21	45	111	135	108	139	0.86
6	7	0.0037	0.68	9.8	0.0	21	51	139	169	135	170	0.87
7	7	0.013	2.3	8.1	0.0	21	47	167	192	165	198	0.85

Coding Sequence: atgccacaccaatgcacCGTGTGTGCCAAAGTGGTCCGCTCGATGTCGGCCCTGGCACTGCACCTTCGAAGCCACACTGGCGAGAAGCCGTTCGAATGTTCAGTGTGCGTCAagaaatttagttgcggtacACATCTTAGAAGGCACCGTCTCACTCACACCggagagaagcctttcgaaTGTTTGGtatgcaacaagaagtttacGACGGTTGACAaccttaaaacgCATCTCCATTCACACACCGGAGAAAAGCCTTTCAAATGTTCGGTCTGCAACAAAAAATTTAGTCAAAGTGGAAACCGAGATAAGCATCTCCTCAcacacaccggggagaagcctttcgaatGTTCGGTTTGCCAAAACAGGTTCGGTTTGGCTCGATCCCTTGAAATACATCTCCGTTGTCACACCGGAGAGAGGCCTTTCGAATGTTCGGtgtgcaacaagaagttcagtgAAAGCGGAAAGCTGAAAAGGCATCTCCTCTtacacaccggggagaagcctttcgaatGTTCGGTCTGCAAAAAGATGTTTCGTTGGGCTGGATCCTTTAAAAGACATCTCCGTCGTCACACTGGAGAGAGGCCTCTCGAATGA
Protein Sequence: MPHQCTVCAKVVRSMSALALHLRSHTGEKPFECSVCVKKFSCGTHLRRHRLTHTGEKPFECLVCNKKFTTVDNLKTHLHSHTGEKPFKCSVCNKKFSQSGNRDKHLLTHTGEKPFECSVCQNRFGLARSLEIHLRCHTGERPFECSVCNKKFSESGKLKRHLLLHTGEKPFECSVCKKMFRWAGSFKRHLRRHTGERPLE

Sequence clustering based on sequence similarity using MMseqs2