Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.018 3.3 7.6 0.0 21 45 4 28 2 35 0.91

2 5 0.016 2.8 7.8 0.0 21 44 60 83 53 87 0.91

3 5 0.019 3.4 7.5 0.1 21 46 88 113 85 119 0.86

4 5 0.015 2.7 7.8 0.0 21 46 116 141 112 147 0.86

5 5 0.017 3 7.7 0.2 21 47 144 170 140 176 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.018	3.3	7.6	0.0	21	45	4	28	2	35	0.91
2	5	0.016	2.8	7.8	0.0	21	44	60	83	53	87	0.91
3	5	0.019	3.4	7.5	0.1	21	46	88	113	85	119	0.86
4	5	0.015	2.7	7.8	0.0	21	46	116	141	112	147	0.86
5	5	0.017	3	7.7	0.2	21	47	144	170	140	176	0.86

Coding Sequence: ATGCATAAAGGGGAGAAACCTTTTGAGTGCGCAGTTTGCAACAAGACTTTCAGCCAAAAGAGTGTACTCAGGAGTCACCTTCGGACCCATTCAGGGGAGAATCCTTTCGAAGGCGCTGTTTGCAAGAAGACTTTTAGCCGGAAGGATCACGTCAGCGCTCACCTTCGGACCcatacaggggagaagccttttgagtgcTCAGTTTGTAACAGAACTTTCAGCGAAGGGGGTAAACTCAGGAGGCACCTTTGGACCCATACAGGGGAGAAACCGtttgagtgcacagtttgcaacaagacTTTTAGCGTTGAATGTAACCTCAGGACTCACCTTCGGACCCATACAGGGGAGAAACCTTTTGAGTGCGCAGTTTGCAACAAGACTTTTAGCGTTGAATATAACCTCAGGACTCACCTTCGGACCCATACGGGAGAGAAACCTTTTGAGTGCGCAGTTTGCAACGAGACTTTTAGCGTTGAATGTAACCTCAGGACTCACCTTCGGACCCATACAGGAGAGAAACCTTTTGAGTGCAGTTTGTAA
Protein Sequence: MHKGEKPFECAVCNKTFSQKSVLRSHLRTHSGENPFEGAVCKKTFSRKDHVSAHLRTHTGEKPFECSVCNRTFSEGGKLRRHLWTHTGEKPFECTVCNKTFSVECNLRTHLRTHTGEKPFECAVCNKTFSVEYNLRTHLRTHTGEKPFECAVCNETFSVECNLRTHLRTHTGEKPFECSL

Sequence clustering based on sequence similarity using MMseqs2