Basic Information

Insect: Thrips palmi
Gene Symbol: -
Assembly: GCA_012932325.1
Location: NW:4328907-4343097[-]

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 17 0.012 2.1 8.2 1.5 16 45 24 52 19 56 0.80

2 17 0.26 48 3.9 0.0 18 46 53 81 51 88 0.85

3 17 7.1 1.3e+03 -0.7 0.3 22 44 85 107 80 121 0.67

4 17 2.4 4.4e+02 0.8 0.2 22 44 113 135 106 139 0.81

5 17 0.018 3.3 7.6 0.1 4 45 123 164 119 168 0.78

6 17 0.24 43 4.0 0.0 21 46 168 193 164 199 0.85

7 17 0.88 1.6e+02 2.2 0.0 21 45 196 220 192 223 0.88

8 17 0.5 91 3.0 0.0 21 46 224 249 220 257 0.85

9 17 8.9 1.6e+03 -1.1 0.1 21 44 252 275 249 287 0.78

10 17 1.3 2.4e+02 1.6 0.1 22 45 281 304 263 311 0.83

11 17 0.012 2.2 8.1 0.0 6 46 293 333 290 339 0.75

12 17 0.38 69 3.3 0.0 21 45 336 360 332 363 0.89

13 17 0.5 91 3.0 0.0 21 46 364 389 360 397 0.85

14 17 8.6 1.6e+03 -1.0 0.0 21 44 392 415 384 422 0.76

15 17 0.45 83 3.1 0.0 22 45 421 444 412 448 0.86

16 17 0.0082 1.5 8.7 0.1 21 45 448 472 444 476 0.91

17 17 0.56 1e+02 2.8 0.0 22 45 477 500 473 503 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	17	0.012	2.1	8.2	1.5	16	45	24	52	19	56	0.80
2	17	0.26	48	3.9	0.0	18	46	53	81	51	88	0.85
3	17	7.1	1.3e+03	-0.7	0.3	22	44	85	107	80	121	0.67
4	17	2.4	4.4e+02	0.8	0.2	22	44	113	135	106	139	0.81
5	17	0.018	3.3	7.6	0.1	4	45	123	164	119	168	0.78
6	17	0.24	43	4.0	0.0	21	46	168	193	164	199	0.85
7	17	0.88	1.6e+02	2.2	0.0	21	45	196	220	192	223	0.88
8	17	0.5	91	3.0	0.0	21	46	224	249	220	257	0.85
9	17	8.9	1.6e+03	-1.1	0.1	21	44	252	275	249	287	0.78
10	17	1.3	2.4e+02	1.6	0.1	22	45	281	304	263	311	0.83
11	17	0.012	2.2	8.1	0.0	6	46	293	333	290	339	0.75
12	17	0.38	69	3.3	0.0	21	45	336	360	332	363	0.89
13	17	0.5	91	3.0	0.0	21	46	364	389	360	397	0.85
14	17	8.6	1.6e+03	-1.0	0.0	21	44	392	415	384	422	0.76
15	17	0.45	83	3.1	0.0	22	45	421	444	412	448	0.86
16	17	0.0082	1.5	8.7	0.1	21	45	448	472	444	476	0.91
17	17	0.56	1e+02	2.8	0.0	22	45	477	500	473	503	0.86

Sequence Information

Coding Sequence: ATGATCACGCGGAAGAAATTTTCCCAGTGCCCTGTTCGAAACGGTCCACTTTGCGACGCCAATAGCCTCAGAACACGCACAAAAAAAGAGTCTTGTGAATGTCCAGTTTGCAAAAAGAAGATAAGCCATCGACGCAATCTACCGACTCATCTCAGGAGGcatacaggggagaagcctttcgagtgcacagtttgcaacaagaagtttaaTCAAGCAAGCGATGTCAAAATACATCTCAGAACTcatacaggggagaagcctttcgagtgcgcagtttgcaacaagaagtttaaTCATGCAAGCAAGGTCAAAATACATCTCAGAACCCATACAGGGGAGAAGTCTTTCGAGTGCccagtttgcaacaagaagtttaaGCATGCAAGCACTGTCAAAAGTCATCTCAGAACCcacacaggggagaagccttttgaatgcacagtttgcaacaagaagtttaaTGAAGCAAGCGATCTCAGGAAACATCTCAGAACCcatacaggggagaagcctttcgagtgtgctgtttgcaacaagaagtttaaACAAGCAAGCGATGTCAAAATACATCTCAGAACTcatacaggggagaagcctttcgagtgcgcagtttgcaacaagaagtttaaTCAAGCAAGCGATGTCAAAATACATCTCAGAACTcatacaggggagaagcctttcgagtgcgcagtttgcaacaagaagtttaaTCAAGCAAGCGATGTCAAAATACATCTCAGAACTcatacaggggagaagcctttcgagtgcacagtttgcaacaagaagtttaaTCATGCAAGCAAGGTCAAAATACATCTCAGAACCCATACAGGGGAGAAGTCTTTCGAGTGCccagtttgcaacaagaagtttaaGCATGCAAGCACTGTCAAAAGTCATCTCAGAACCcacacaggggagaagccttttgaatgcacagtttgcaacaagaagtttaaTGAAGCAAGCGATCTCAGGAAACATCTCAGAACCcatacaggggagaagcctttcgagtgtgctgtttgcaacaagaagtttaaACAAGCAAGCGATGTCAAAATACATCTCAGAACTcatacaggggagaagcctttcgagtgcgcagtttgcaacaagaagtttaaTCAAGCAAGCGATGTCAAAATACATCTCAGAACTcatacaggggagaagcctttcgagtgcacagtttgcaacaagaagtttagTCATGCAAGCAAGGTCAAAATACATCTCAGAACCCATACAGGGGAGAAGTCTTTCGAGTGCgcagtttgcaacaagaagttcagtaGAACGGACAATCTCAGAACTCATCTCAGAACCCATACAGGGGAGCAGCCTtacgagtgcacagtttgcaataAGAAGTTCAGTAGAACGGGCAATCTCAGAACTCATCTCAGAACCCATACAGGGGAGAAGTCTTTCGAGTGCgcagtttgcaacaagaagttcagtaGAACGGACAATCTCAGAACTCATCTCAGAACCCATACAGGGTAG
Protein Sequence: MITRKKFSQCPVRNGPLCDANSLRTRTKKESCECPVCKKKISHRRNLPTHLRRHTGEKPFECTVCNKKFNQASDVKIHLRTHTGEKPFECAVCNKKFNHASKVKIHLRTHTGEKSFECPVCNKKFKHASTVKSHLRTHTGEKPFECTVCNKKFNEASDLRKHLRTHTGEKPFECAVCNKKFKQASDVKIHLRTHTGEKPFECAVCNKKFNQASDVKIHLRTHTGEKPFECAVCNKKFNQASDVKIHLRTHTGEKPFECTVCNKKFNHASKVKIHLRTHTGEKSFECPVCNKKFKHASTVKSHLRTHTGEKPFECTVCNKKFNEASDLRKHLRTHTGEKPFECAVCNKKFKQASDVKIHLRTHTGEKPFECAVCNKKFNQASDVKIHLRTHTGEKPFECTVCNKKFSHASKVKIHLRTHTGEKSFECAVCNKKFSRTDNLRTHLRTHTGEQPYECTVCNKKFSRTGNLRTHLRTHTGEKSFECAVCNKKFSRTDNLRTHLRTHTG

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01435209;
90% Identity: iTF_01435209;
80% Identity: iTF_01435209;