Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 1.2 2.2e+02 1.7 0.0 21 44 27 50 21 55 0.84

2 6 0.003 0.54 10.1 0.0 21 47 55 81 51 87 0.86

3 6 0.88 1.6e+02 2.2 0.0 21 45 83 107 79 110 0.85

4 6 0.00033 0.061 13.1 0.0 21 44 111 134 107 138 0.90

5 6 0.0011 0.2 11.4 0.0 21 46 139 164 136 170 0.87

6 6 0.64 1.2e+02 2.6 0.0 21 45 167 191 163 194 0.87

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	1.2	2.2e+02	1.7	21	44	27	50	21	55	0.84
2	6	0.003	0.54	10.1	21	47	55	81	51	87	0.86
3	6	0.88	1.6e+02	2.2	21	45	83	107	79	110	0.85
4	6	0.00033	0.061	13.1	21	44	111	134	107	138	0.90
5	6	0.0011	0.2	11.4	21	46	139	164	136	170	0.87
6	6	0.64	1.2e+02	2.6	21	45	167	191	163	194	0.87

Coding Sequence: ATGAGCCACGAGTGTCCAGTATGCGGTAAGAAGAATGTGTCCGGGTCCAAACTGGCTGCTCACCTCCGGACCCACACAGGAGAAAAGCCCTTTGAGTGCGCAGTTTGTAACAAGAAGTTCAGCGAAGTCGGTCACCTCAGAACGCACTTCCGGACCCACACAGGAGAGAAGCCCTTTGAATGTGCAGTTTGCTACACGAAGTTCAGCGAAGGTGGCCACCTCAGAACGCACCTCCGGACTCACACAggagagaagccttttgagtgcacagtttgcaacaagaagttcagccTAGGTGGCCACCTCAGAACGCACCTCCGGACCCACACGGGAGAGaagccctttgagtgcaccgtttgcaacaagaagttcagccAAAGTGGCAATCTCAGAAAACATATCCTGATCCACACAGGAGAGAGGCCCtttgagtgcacagtttgcaacaagaagttcagcaATGGAAGCAACCTCAGAAGGCACCTCCGGACCCATACAGGAGAGaagccctttgagtgcacactttgcaacaagaagttcagccGAGGTGGCCACCTCAGAATGCATCTGCGAACCCACACGGAGGAACGCTGA
Protein Sequence: MSHECPVCGKKNVSGSKLAAHLRTHTGEKPFECAVCNKKFSEVGHLRTHFRTHTGEKPFECAVCYTKFSEGGHLRTHLRTHTGEKPFECTVCNKKFSLGGHLRTHLRTHTGEKPFECTVCNKKFSQSGNLRKHILIHTGERPFECTVCNKKFSNGSNLRRHLRTHTGEKPFECTLCNKKFSRGGHLRMHLRTHTEER

Sequence clustering based on sequence similarity using MMseqs2