Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.093 17 5.3 0.0 21 48 27 54 19 58 0.86

2 8 0.034 6.3 6.7 0.0 21 45 55 79 52 86 0.87

3 8 0.26 48 3.8 0.0 22 46 84 108 79 114 0.85

4 8 0.32 58 3.6 0.0 22 45 112 135 107 138 0.89

5 8 0.028 5.1 7.0 0.0 21 46 139 164 135 170 0.86

6 8 0.2 36 4.2 0.0 22 46 168 192 163 198 0.85

7 8 0.14 26 4.7 0.0 22 46 196 220 191 226 0.85

8 8 0.033 6.1 6.7 0.1 22 45 224 247 219 250 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.093	17	5.3	0.0	21	48	27	54	19	58	0.86
2	8	0.034	6.3	6.7	0.0	21	45	55	79	52	86	0.87
3	8	0.26	48	3.8	0.0	22	46	84	108	79	114	0.85
4	8	0.32	58	3.6	0.0	22	45	112	135	107	138	0.89
5	8	0.028	5.1	7.0	0.0	21	46	139	164	135	170	0.86
6	8	0.2	36	4.2	0.0	22	46	168	192	163	198	0.85
7	8	0.14	26	4.7	0.0	22	46	196	220	191	226	0.85
8	8	0.033	6.1	6.7	0.1	22	45	224	247	219	250	0.89

Coding Sequence: ATGGGTCACGACTGTCCAGTGTGCGGCAAGAAGAATGAGTCCGTGTCCAAGCTGACTGTGCACCTGCGGACCCACACGggagagaagccttttgagtgcacggtttgcaacaagaagtttagCCATCGTTGCAACCTCAAAACGCACCTCGGGATCCACACAGGAGAGAAGCCCTTGGAGTGcacggtttgcaacaagaaatTCAGCCAAGGTAGCAGCCTCAGAAAGCATTTCCGGACCCACACAGGGGACaagccttttgagtgcacggtgtgcaacaagaagttcaccGCAAGTGGCAGCCTCAGAGTGCATCTCCGGACCCACACTGGGGAcaagccctttgagtgcacggtctgcaacaagaagttcaacCAAGGTGGCGGCCTCAGAGTGCATCTCCGGACCcacacaggggagaagccctttgagtgcacggtctgcaacaagaagttcaacCAAGGTGGCGACCTCAGAGTGCATCTCCGGACCCACACAGGGGAcaagccctttgagtgcacggtttgcaacaagaagttcgcCGAAAGTGGCAGCCTCAGAGTGCATCTCCGGACCCACACAGGAGAcaagccctttgagtgcacggtttgcaacaagaagttcaccAGAAGTGGCAAGCTCAGAGTACACCTCCGGACCCACACAGGGGAcaagccctttgagtgcacggtttgcaacaagaagttcaggCAAAACTCTCATCTGAAAACGCACCTGCGAACCCACACTGAAGGAAACGATTTGAACATCGAGTTGGCAAATAGGAGTTAA
Protein Sequence: MGHDCPVCGKKNESVSKLTVHLRTHTGEKPFECTVCNKKFSHRCNLKTHLGIHTGEKPLECTVCNKKFSQGSSLRKHFRTHTGDKPFECTVCNKKFTASGSLRVHLRTHTGDKPFECTVCNKKFNQGGGLRVHLRTHTGEKPFECTVCNKKFNQGGDLRVHLRTHTGDKPFECTVCNKKFAESGSLRVHLRTHTGDKPFECTVCNKKFTRSGKLRVHLRTHTGDKPFECTVCNKKFRQNSHLKTHLRTHTEGNDLNIELANRS

Sequence clustering based on sequence similarity using MMseqs2