Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.075 14 5.6 0.0 21 45 27 51 19 58 0.87

2 10 0.14 26 4.7 0.0 22 45 56 79 51 86 0.83

3 10 0.13 23 4.8 0.0 22 46 84 108 80 114 0.85

4 10 0.24 44 4.0 0.0 22 47 112 137 107 143 0.84

5 10 0.017 3.1 7.7 0.1 22 47 140 165 135 171 0.85

6 10 0.16 30 4.5 0.0 22 52 168 198 163 199 0.87

7 10 0.098 18 5.2 0.0 23 47 197 221 193 227 0.85

8 10 0.0028 0.52 10.2 0.1 22 52 224 254 219 255 0.86

9 10 0.24 44 4.0 0.0 22 46 252 276 249 283 0.89

10 10 0.19 36 4.3 0.2 26 45 284 303 278 306 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.075	14	5.6	0.0	21	45	27	51	19	58	0.87
2	10	0.14	26	4.7	0.0	22	45	56	79	51	86	0.83
3	10	0.13	23	4.8	0.0	22	46	84	108	80	114	0.85
4	10	0.24	44	4.0	0.0	22	47	112	137	107	143	0.84
5	10	0.017	3.1	7.7	0.1	22	47	140	165	135	171	0.85
6	10	0.16	30	4.5	0.0	22	52	168	198	163	199	0.87
7	10	0.098	18	5.2	0.0	23	47	197	221	193	227	0.85
8	10	0.0028	0.52	10.2	0.1	22	52	224	254	219	255	0.86
9	10	0.24	44	4.0	0.0	22	46	252	276	249	283	0.89
10	10	0.19	36	4.3	0.2	26	45	284	303	278	306	0.90

Coding Sequence: ATGGGTCACGACTGTCCAGTGTGCGGCAAGAAGAATGAGTCCGCGTCCAAGCTGACTGTGCACCTGCGGACCCACACgggggagaagccttttgagtgcacagtttgcaccAGAAAGTTCGCCCAAGGTGGCCACCTAAGAGCGCATCTCCGGTCCCACACAGGAGAcaagccctttgagtgcacggTTTGCAACAGGAAGTTCATCGGTAGTGGTGACCTCAGAAAGCATCTCCGAAACCACACTGGGGACaagccttttgagtgcacagtttgcaacagAAAGTTCACCCAAGGTGGCGACCTCAGAGCGCATCTGCGGACCCACACAGGAGAcaagccctttgagtgcacggTTTGCAACAGAAAGTTCACCACAGGTGGCAATCTCAGAGTGCATCTCCGGACCCACACAGGAGAcaagccctttgagtgcacggtttgcaacaagaagttcgcCGAAAGTTGCAACCTCAGAGTGCATCTCCGGACCCACACAGGAGAcaagccctttgagtgcacggtctgcaacaagaagttcaccATAAGTGGCAGCCTGAGAATGCATCTCCGGATCCACACAGGAGGCaagccttttgagtgcacGGTTTGCAACAGGAAGTTTAGCCAAGGTGGCAGCCTCAGAAAGCATCTCCGGACCCACACAGGAGACaagccttttgagtgcacggtttgcaacaagaagttcatcGAAAGTTGCAACCTCAGAAAGCATCTGCGGATCCACACAGGAGAcaagccctttgagtgcacggtctgcaacaagaagttcaccACAAGTGGCAGCCTGAGAATGCATCTCCGGATCCACACAGGCGACAAGCGCTTTGAGTGCACGGTTTGCAGCAAGAGGTTCAGGCAAAACTCTCATCTGAAAAAGCACCTGCGAACCCACACTGAAGGAAACGATTTGATCGTCGAGTTGGCAAATAGGAGTTAA
Protein Sequence: MGHDCPVCGKKNESASKLTVHLRTHTGEKPFECTVCTRKFAQGGHLRAHLRSHTGDKPFECTVCNRKFIGSGDLRKHLRNHTGDKPFECTVCNRKFTQGGDLRAHLRTHTGDKPFECTVCNRKFTTGGNLRVHLRTHTGDKPFECTVCNKKFAESCNLRVHLRTHTGDKPFECTVCNKKFTISGSLRMHLRIHTGGKPFECTVCNRKFSQGGSLRKHLRTHTGDKPFECTVCNKKFIESCNLRKHLRIHTGDKPFECTVCNKKFTTSGSLRMHLRIHTGDKRFECTVCSKRFRQNSHLKKHLRTHTEGNDLIVELANRS

Sequence clustering based on sequence similarity using MMseqs2