Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 4.7 8.6e+02 -0.2 0.2 24 35 2 13 1 25 0.66

2 8 0.012 2.2 8.1 0.0 21 46 27 52 23 58 0.86

3 8 3e-05 0.0055 16.5 0.0 21 50 55 84 51 86 0.87

4 8 0.15 28 4.6 0.0 21 48 83 110 81 114 0.84

5 8 0.22 41 4.1 0.0 21 46 111 136 107 142 0.85

6 8 0.0014 0.26 11.1 0.0 21 46 139 164 126 170 0.81

7 8 0.086 16 5.4 0.3 21 45 167 191 163 198 0.85

8 8 2.3 4.2e+02 0.8 0.1 21 33 195 207 192 211 0.80

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	4.7	8.6e+02	-0.2	0.2	24	35	2	13	1	25	0.66
2	8	0.012	2.2	8.1	0.0	21	46	27	52	23	58	0.86
3	8	3e-05	0.0055	16.5	0.0	21	50	55	84	51	86	0.87
4	8	0.15	28	4.6	0.0	21	48	83	110	81	114	0.84
5	8	0.22	41	4.1	0.0	21	46	111	136	107	142	0.85
6	8	0.0014	0.26	11.1	0.0	21	46	139	164	126	170	0.81
7	8	0.086	16	5.4	0.3	21	45	167	191	163	198	0.85
8	8	2.3	4.2e+02	0.8	0.1	21	33	195	207	192	211	0.80

Coding Sequence: ATGCCCGCCCAATGCGCAGTGTGCAAGAAGGCGTTCCCATCGCAGTCGGCGCTGGCTGTGCACCTccgcacccacaccggggagaagcccttCGAATGTTCAGTCTGCAACATGAAGTTTAATGTAGGTGGAAACCTTCGAAAGCACCTCCGCActcacaccggggagaagcccttCGAATGTTTGGTCTGCTACATGAAATTTAGTGAAACTGGAAACCTCCGAAGGCACCTCCgcatccacaccggggagaagcccttCGAATGTTCGGtatgcaacaagaagttcagtgTAGCTGAAGGCCTTCGACAGCACCTCCGCACTCACACCGCGGAGAAGCCCTTTGAATGTTCAGTCTGCAACATGAAGTTTAATTTAGCTGGAACCCTGAGAACGCACCTCCGCACCCATACTGGGGAGAAGCCCTTCGAATGTTCGGTATGCACCAAGAAGTTTAGTGGAACTGGAAACCTTCGAAGGCACCTCCGTACtcacactggggagaagccttacgAATGTTCAGTATGCAACCAGAAGTTTAGTGAAAGAGAAAGCGTGAGAAGGCACCTCCTaacccacaccggggagaagcccttCAAATGTTCCATATGCAACCAGAAGTTCAGGAAGCTGGGAACCTTCGAAGGCACCTCCGCTCTCACACCAGGGAAAAGCCCTTCGAATGTTCAGTCTGCAACAAGAGGTTTGGTCAAAGTGGAACCCTGA
Protein Sequence: MPAQCAVCKKAFPSQSALAVHLRTHTGEKPFECSVCNMKFNVGGNLRKHLRTHTGEKPFECLVCYMKFSETGNLRRHLRIHTGEKPFECSVCNKKFSVAEGLRQHLRTHTAEKPFECSVCNMKFNLAGTLRTHLRTHTGEKPFECSVCTKKFSGTGNLRRHLRTHTGEKPYECSVCNQKFSERESVRRHLLTHTGEKPFKCSICNQKFRKLGTFEGTSALTPGKSPSNVQSATRGLVKVEP

Sequence clustering based on sequence similarity using MMseqs2