Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.077 14 5.6 0.0 21 46 27 52 20 58 0.83

2 8 0.6 1.1e+02 2.7 0.0 21 45 55 79 51 82 0.87

3 8 0.032 5.8 6.8 0.0 21 47 83 109 79 114 0.84

4 8 0.02 3.7 7.4 0.0 21 50 111 140 108 142 0.90

5 8 0.47 86 3.0 0.0 22 44 168 190 157 195 0.89

6 8 0.082 15 5.5 0.0 21 45 195 219 192 226 0.86

7 8 0.032 5.9 6.8 0.0 21 46 223 248 220 254 0.86

8 8 0.26 48 3.8 0.2 21 45 251 275 247 281 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.077	14	5.6	0.0	21	46	27	52	20	58	0.83
2	8	0.6	1.1e+02	2.7	0.0	21	45	55	79	51	82	0.87
3	8	0.032	5.8	6.8	0.0	21	47	83	109	79	114	0.84
4	8	0.02	3.7	7.4	0.0	21	50	111	140	108	142	0.90
5	8	0.47	86	3.0	0.0	22	44	168	190	157	195	0.89
6	8	0.082	15	5.5	0.0	21	45	195	219	192	226	0.86
7	8	0.032	5.9	6.8	0.0	21	46	223	248	220	254	0.86
8	8	0.26	48	3.8	0.2	21	45	251	275	247	281	0.85

Coding Sequence: ATGCCAGTCCAGTGCGCAGTTTGCGGTCGACGGTTCGTCTGGTCGTCATCGCTATCCGTGCATTCAAGGATCCACACCGGAGAGAAGCCCTTCGAGTGTAAAGTGTGCATGAAAAAGTTCACTCAGAGAGGACTCCTTACGCGCCACCTCCGCACCCACACCGGAGAGAAGCCCTTCGAGTGCACTGTCTGCATGAAGAAGTTCTCTCAGAAAGGACAACTTACAATGCATCTCCGCACCCACACCGGAGAGCAGCCCTTCGAGTGCACTGTCTGCATGAAGAAGTTTAGTCTAAGAGATACGCTCAAAAGGCATCTTCTCATTCACACCggagagaagcctttcgagtgcgcgGTCTGCATGAGGGATTTTCGCGATGTTCAATCCCTGAAGGAGCACCTCCTCGTCACCCACACCGAAAAGCTTTTTGAGTGCACGGTTTGCACAAAGAAGTTCAGTACGGGAAAAACTCTGAAGAAGCACGTCATGACGCACACTGGACAGAGGCCTTTTGAGTGCACGGTCTGCATGAAGAAGTTCCGTATGGGAGGCGCCCTGAAGAAGCACCTCGTCACCCACACTGGAGAAAAGCCTTTTGAGTGTACGGTCTGCATGAAAACGTTCCTTGACACAGGAAGCCTTAAAAGGCACCTGCTTACGCACACCGGGGAGAAACCGTTTGAATGCACAGTCTGCAGTAAGAAGTTTATCTCATCGTCAAACCTCCGTGTACACATTCGGACGCACACTGGTGAGAAGCCCTTCGAGTGTGCGGTTTGCACCAAGAAATTTAAGCACATGGCTTCCCTCCGGCACCACAtccgcgcccacactgcgaaGATGTCTTGA
Protein Sequence: MPVQCAVCGRRFVWSSSLSVHSRIHTGEKPFECKVCMKKFTQRGLLTRHLRTHTGEKPFECTVCMKKFSQKGQLTMHLRTHTGEQPFECTVCMKKFSLRDTLKRHLLIHTGEKPFECAVCMRDFRDVQSLKEHLLVTHTEKLFECTVCTKKFSTGKTLKKHVMTHTGQRPFECTVCMKKFRMGGALKKHLVTHTGEKPFECTVCMKTFLDTGSLKRHLLTHTGEKPFECTVCSKKFISSSNLRVHIRTHTGEKPFECAVCTKKFKHMASLRHHIRAHTAKMS

Sequence clustering based on sequence similarity using MMseqs2