Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.035 6.4 6.7 0.4 14 45 20 51 7 55 0.86

2 5 0.00019 0.035 13.9 0.2 21 45 55 79 51 82 0.91

3 5 0.033 6 6.7 0.0 21 46 83 108 79 114 0.86

4 5 0.00073 0.13 12.0 0.0 21 51 111 141 107 142 0.87

5 5 0.0024 0.45 10.4 0.0 21 48 139 166 137 170 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.035	6.4	6.7	0.4	14	45	20	51	7	55	0.86
2	5	0.00019	0.035	13.9	0.2	21	45	55	79	51	82	0.91
3	5	0.033	6	6.7	0.0	21	46	83	108	79	114	0.86
4	5	0.00073	0.13	12.0	0.0	21	51	111	141	107	142	0.87
5	5	0.0024	0.45	10.4	0.0	21	48	139	166	137	170	0.91

Coding Sequence: ATGTCCCGCGAGCGTGAGCCCCGTCACCGCACTGGTGGATCTTCAGCGTCCGGGCGTGCTCCACGCGGTGTCTGCAATGGAGAGAAGCGTCTGGAGTGTCCAGTGTGCGAGAAGCAGTTCGCCTCAAGAAGTAAACTAGAAAGGCACCTTCggacccacaccggggagaagcctttcgagtgctcGGTGTGCCAGGAGAAGTTCACTCAAAGTGCATCTCTCAGAAGGCATCTTCGGAcccacactggggagaagcctttcgagtgcacagtttgcaagaaGAGCTTCAATGAATGTGGAAGTCTCAGAAAGCAccttcgcacccacaccggggagaagccatttgagtgcacagtttgccaGAAGAAGTTCGCTCAAAGTGGAGATCTCAGAACACACCTCCgcatccacaccggggagaagcctttcgagtgcacagtttgcaagaaGAAGTTCGCTCAAAGTGGACACCTTAGAGGACACCTCCGCtttccacaccggggagaagcctctcgagtgcacagtttgcaagaaGAAGTTCGTTCGTAG
Protein Sequence: MSREREPRHRTGGSSASGRAPRGVCNGEKRLECPVCEKQFASRSKLERHLRTHTGEKPFECSVCQEKFTQSASLRRHLRTHTGEKPFECTVCKKSFNECGSLRKHLRTHTGEKPFECTVCQKKFAQSGDLRTHLRIHTGEKPFECTVCKKKFAQSGHLRGHLRFPHRGEASRVHSLQEEVRS

Sequence clustering based on sequence similarity using MMseqs2