Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.006 1.1 9.1 0.0 21 51 27 57 19 59 0.87

2 10 1 1.9e+02 1.9 0.0 21 45 55 79 53 87 0.84

3 10 0.18 33 4.4 0.0 22 46 84 108 79 114 0.88

4 10 0.16 30 4.5 0.0 21 46 111 136 108 142 0.86

5 10 0.38 70 3.3 0.0 22 46 140 164 135 170 0.84

6 10 0.016 2.8 7.8 0.0 22 47 168 193 163 199 0.85

7 10 0.72 1.3e+02 2.5 0.0 22 51 196 225 191 227 0.85

8 10 0.37 67 3.4 0.0 22 46 224 248 221 254 0.85

9 10 0.0011 0.2 11.5 0.0 22 45 252 275 247 281 0.89

10 10 0.2 36 4.3 0.3 26 45 284 303 277 306 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.006	1.1	9.1	0.0	21	51	27	57	19	59	0.87
2	10	1	1.9e+02	1.9	0.0	21	45	55	79	53	87	0.84
3	10	0.18	33	4.4	0.0	22	46	84	108	79	114	0.88
4	10	0.16	30	4.5	0.0	21	46	111	136	108	142	0.86
5	10	0.38	70	3.3	0.0	22	46	140	164	135	170	0.84
6	10	0.016	2.8	7.8	0.0	22	47	168	193	163	199	0.85
7	10	0.72	1.3e+02	2.5	0.0	22	51	196	225	191	227	0.85
8	10	0.37	67	3.4	0.0	22	46	224	248	221	254	0.85
9	10	0.0011	0.2	11.5	0.0	22	45	252	275	247	281	0.89
10	10	0.2	36	4.3	0.3	26	45	284	303	277	306	0.89

Coding Sequence: ATGGGTCACGACTGTCCAGTGTGCGGCAAGAAGAATGAGTCCGCGTCCAGGCTGACTGTGCACCTGCGGACCCACACGggagagaagccttttgagtgcacggtctgcaacaagaagttcagccAACGTAACAACCTCAAAACGCACCTCGGGATCCACACAGGAGAGAAGCCCCTGGAGTGcacggtttgcaacaagaagttcagccTAGGTAGCAGCCTCAGAAAGCATTTCCGGACCCACACAGGAGAcaagccctttgagtgcacggtttgcaacaagaagttcaccGAAAGTGGCAGCCTCAGAGTGCATCTCCGGATCCACACAGGGGAAAGgccctttgagtgcacggtttgcaacaagaagttcatcGAAAGTGGCAAGCTCAGAGTACACCTCCGGACCCACACAGGAGACaagccttttgagtgcacGGTCTGCAATAAGAGGTTCTTCCATGGTGGCAATCTCAGAGTGCATCTCCGAACCCACACAGGAGACaagccttttgagtgcacggtctgcaacaagaagttcgtCCAAGGTAGTAACCTCAGAGTGCATCTCCGGACCCACACAGGGGAcaagccctttgagtgcatggtttgcaacaagaagttcgcCGAAAGTGGCAGCGTCAGAGTGCATCTGCGGATTCACGCAGGAGAcaagccctttgagtgcacggtctgcaacaagaagttcaccAGAAGTGACATCCTCAGAATGCATCTCCGGACCCACACAGGAGAcaagccctttgagtgcacggtttgcaacaagaagttcatcCAAAGTGGCAACCTCAGAAAGCATCTCCGGACCCACACAGGAGACAAGCGCTTTGAGTGCACGGTTTGCAGCAAGAGGTTCAGGCAAAACTcccatctgaaaaagcatctGCGAACCCACACTGGAGGACACGATTTGAACATCCAGTTGGCAAATGGCAGTTAA
Protein Sequence: MGHDCPVCGKKNESASRLTVHLRTHTGEKPFECTVCNKKFSQRNNLKTHLGIHTGEKPLECTVCNKKFSLGSSLRKHFRTHTGDKPFECTVCNKKFTESGSLRVHLRIHTGERPFECTVCNKKFIESGKLRVHLRTHTGDKPFECTVCNKRFFHGGNLRVHLRTHTGDKPFECTVCNKKFVQGSNLRVHLRTHTGDKPFECMVCNKKFAESGSVRVHLRIHAGDKPFECTVCNKKFTRSDILRMHLRTHTGDKPFECTVCNKKFIQSGNLRKHLRTHTGDKRFECTVCSKRFRQNSHLKKHLRTHTGGHDLNIQLANGS

Sequence clustering based on sequence similarity using MMseqs2