Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.0012 0.22 11.4 0.1 21 48 27 54 19 58 0.83

2 7 0.0058 1.1 9.1 0.1 21 46 55 80 50 89 0.87

3 7 0.003 0.56 10.0 0.1 20 45 110 135 97 142 0.84

4 7 0.77 1.4e+02 2.3 0.0 25 44 143 162 135 170 0.79

5 7 0.0059 1.1 9.1 0.1 26 45 172 191 168 196 0.89

6 7 0.065 12 5.8 0.0 27 46 201 220 199 226 0.85

7 7 0.01 1.9 8.4 0.7 21 51 223 253 219 254 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.0012	0.22	11.4	0.1	21	48	27	54	19	58	0.83
2	7	0.0058	1.1	9.1	0.1	21	46	55	80	50	89	0.87
3	7	0.003	0.56	10.0	0.1	20	45	110	135	97	142	0.84
4	7	0.77	1.4e+02	2.3	0.0	25	44	143	162	135	170	0.79
5	7	0.0059	1.1	9.1	0.1	26	45	172	191	168	196	0.89
6	7	0.065	12	5.8	0.0	27	46	201	220	199	226	0.85
7	7	0.01	1.9	8.4	0.7	21	51	223	253	219	254	0.85

Coding Sequence: ATGGCCCACAAGTGCGCTGTCTGCGCCAAAGAGATGAGGTGCTTATCGGCGCTCACAGTGCACCTGCGCTCgcacactggggagaagcctttcaaATGCACGGTGTGTAGCAAGAGCTTCAGTCAGAAGAACAACCTTCGAAGCCATGTCCGAGTCCActccggggagaagcctttcgaatGTTCCGTGTGCAGTGTGAGGTTCAGGATAAGTAGCGACCTTCAAAAGCATCTCCAGACTCACACCGGAGAGAAGCATTTTGAGTGCACGCTATGCAGTATGAAGTTCAGCCGTGGAGGCACCCTTCGGAGCCATCTCCGCACCCACACTGGCGAGAAGCCGTACGAATGCACACTGTGCAATGCCAAGTTCAGTCAGGGAGCCGCCCTTCGTACCCACCTGCGAACCCACAGTGGACAGAAGTCGTTTGAGTGCACGATCTGCAACGAGAAGTTTGGTTCCCTTGATAACCTTCGGAGCCACCTGCTGACCCACACCGGGGTGAAGGCCTTCGAGTGCTCAGTCTGCGACAAGAAGTTACGCGACAGCGGAGCCCTGCGAAGGCACCTCCGGACCCACGCCGCGGGAGTGCTGCTAGACTGCACGGTCTGCCACAAGAAGTTTCCTGACAGTGGTAAGCTGCGGCGCCATCTTCGtacccacaccggggagaagcccttCGAGTGCATGGTCTGCCACAAGCAGTTTGGTTGTTGTGATAACCTTCGCCGCCATGTTCGTAGCCACACCGTGGAGAAGCCTTAG
Protein Sequence: MAHKCAVCAKEMRCLSALTVHLRSHTGEKPFKCTVCSKSFSQKNNLRSHVRVHSGEKPFECSVCSVRFRISSDLQKHLQTHTGEKHFECTLCSMKFSRGGTLRSHLRTHTGEKPYECTLCNAKFSQGAALRTHLRTHSGQKSFECTICNEKFGSLDNLRSHLLTHTGVKAFECSVCDKKLRDSGALRRHLRTHAAGVLLDCTVCHKKFPDSGKLRRHLRTHTGEKPFECMVCHKQFGCCDNLRRHVRSHTVEKP

Sequence clustering based on sequence similarity using MMseqs2