Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.11 20 5.0 0.2 21 45 27 51 19 58 0.82

2 10 0.00042 0.077 12.8 0.2 21 45 55 79 51 86 0.87

3 10 0.011 2 8.3 0.1 21 46 83 108 78 114 0.86

4 10 0.012 2.2 8.1 0.2 21 46 111 136 107 142 0.86

5 10 0.62 1.1e+02 2.7 0.1 21 44 139 162 135 165 0.85

6 10 0.021 3.8 7.4 0.1 21 45 167 191 163 194 0.91

7 10 0.0076 1.4 8.8 0.4 21 45 195 219 191 222 0.91

8 10 0.059 11 5.9 0.0 21 44 223 246 219 254 0.85

9 10 0.58 1.1e+02 2.7 0.0 21 45 251 275 247 281 0.87

10 10 0.023 4.2 7.2 0.1 25 47 283 305 275 310 0.81

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.11	20	5.0	0.2	21	45	27	51	19	58	0.82
2	10	0.00042	0.077	12.8	0.2	21	45	55	79	51	86	0.87
3	10	0.011	2	8.3	0.1	21	46	83	108	78	114	0.86
4	10	0.012	2.2	8.1	0.2	21	46	111	136	107	142	0.86
5	10	0.62	1.1e+02	2.7	0.1	21	44	139	162	135	165	0.85
6	10	0.021	3.8	7.4	0.1	21	45	167	191	163	194	0.91
7	10	0.0076	1.4	8.8	0.4	21	45	195	219	191	222	0.91
8	10	0.059	11	5.9	0.0	21	44	223	246	219	254	0.85
9	10	0.58	1.1e+02	2.7	0.0	21	45	251	275	247	281	0.87
10	10	0.023	4.2	7.2	0.1	25	47	283	305	275	310	0.81

Coding Sequence: ATGGCCAACAAATGCACCGTCTGCGCCAAAGTGTTCCTAAAGTTGTCGGCGCTCACAGTGCACCTTCGCTCGCACACTGGGGAGAAACCTTACAAGTGTGCGCTGTGCTGCAAGAGCTTCAGTCTGAAGGACAGCCTTCGTCGCCATGTTCGGACCCACACTGGAGAGAAGCCGTTTGAGTGCTCCGTCTGCAATGTGAAGTTTAGACAGGAAGCCCACCTTCGTCGCCATGTTCGAGCCCACACTggtgagaagccttttgaatGCTCCGTCTGCAATGTGAAGTTTAGACACGAAACGTCCCTTCGGAACCATCTTCGAACtcacactggggagaagccttatGAATGCTCCGTCTGCAATGTGAAGTTTAGACACGAAACGTCCCTTCGGAACCATCTTCGAACCCACACTGGTGAGAAGCCTTATGAATGTTCCGTCTGCAATGTAAAGTTTAGTCGCGAAGGCCACCTTCGGGCCCATCTTGTAACACACACTGGTGAGAAGCCTTATGAATGCTCCGTCTGCAATGTGAAGTTTAGACACGAAACGTCCCTTCGGAACCATCTTCGAAcccacactggggagaagccttttgaaTGCTGCATCTGCAATGTGAACTTTAGACATGACGCCTCCCTTCGTCACCATCTTCGAACCCACACTGGTGAGAAGCCGTTTGAATGTTCCGTCTGCAATGCGAAGTTTAGTCGCGAAGGCCACCTTCGGGCCCATCTTCTAACACACACTGatgagaagccttttgaatGCTCCGTCTGCAACGTGAAGTTTGGTCGTAGAGACTCCCTTCGGAGCCACCTTCGAACCCACACTGGTGAGAAGCTGTTTGAGTGCACGGTCTGCGCCAAGAAGTTTCGTTTCAGTGGCGATCTTCGACGACATGTTCGCACTCACACTGCAGAGAAGCCTTAG
Protein Sequence: MANKCTVCAKVFLKLSALTVHLRSHTGEKPYKCALCCKSFSLKDSLRRHVRTHTGEKPFECSVCNVKFRQEAHLRRHVRAHTGEKPFECSVCNVKFRHETSLRNHLRTHTGEKPYECSVCNVKFRHETSLRNHLRTHTGEKPYECSVCNVKFSREGHLRAHLVTHTGEKPYECSVCNVKFRHETSLRNHLRTHTGEKPFECCICNVNFRHDASLRHHLRTHTGEKPFECSVCNAKFSREGHLRAHLLTHTDEKPFECSVCNVKFGRRDSLRSHLRTHTGEKLFECTVCAKKFRFSGDLRRHVRTHTAEKP

Sequence clustering based on sequence similarity using MMseqs2