Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.0054 0.98 9.3 0.0 18 46 54 83 41 89 0.81

2 9 0.21 38 4.2 0.1 21 45 86 110 82 113 0.90

3 9 0.014 2.6 7.9 0.0 21 51 114 144 110 146 0.87

4 9 0.63 1.2e+02 2.6 0.0 23 46 144 167 141 173 0.85

5 9 0.14 26 4.7 0.0 21 46 170 195 159 201 0.85

6 9 0.14 26 4.7 0.0 21 46 198 223 194 229 0.86

7 9 0.33 60 3.5 0.0 21 45 226 250 222 253 0.90

8 9 0.00032 0.059 13.2 0.1 21 45 254 278 250 286 0.89

9 9 4.6 8.4e+02 -0.1 0.1 21 45 282 306 278 310 0.81

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.0054	0.98	9.3	0.0	18	46	54	83	41	89	0.81
2	9	0.21	38	4.2	0.1	21	45	86	110	82	113	0.90
3	9	0.014	2.6	7.9	0.0	21	51	114	144	110	146	0.87
4	9	0.63	1.2e+02	2.6	0.0	23	46	144	167	141	173	0.85
5	9	0.14	26	4.7	0.0	21	46	170	195	159	201	0.85
6	9	0.14	26	4.7	0.0	21	46	198	223	194	229	0.86
7	9	0.33	60	3.5	0.0	21	45	226	250	222	253	0.90
8	9	0.00032	0.059	13.2	0.1	21	45	254	278	250	286	0.89
9	9	4.6	8.4e+02	-0.1	0.1	21	45	282	306	278	310	0.81

Coding Sequence: ATGGCGGGGAATTCCTGGGAGTGCTACGCCTGCAACAAGACGTTCATCAAGAAGTCGACACTTTCCAGTCATCGTCGAGTCCATCACGTGGATAGGCTGTTCGAGTGCGCAGTTTGCCAAAAGAAGTTCACCCACAGAGGTTCCCTCAATAGACATGTCAGAAGTCAtactggggagaagccttttgagtgcGCGGTTTGCTATAAGAAGTTCAGTGAAACTGGCACACTCCGAATTCATCTCAGAACTcatacaggggagaagccttacgagtgcacagtttgcaacaagaTGTGGAGTACAGCTAGTCACCTTCGATCGCATCTTAAAACTcatacaggggagaagccttttgagtgcGCAGTTTGCGACAAGAAGTTCAGTCAAGCTAGTAGCCTCCGAACTCATCTTAAAACCCACACAGGAGTGAAGCcattcgagtgcacagtttgcagtAAGAAGTTTAACGAATCTGGTACACTCCGAATTCATCTTAGAACTcatacaggggagaagccattcgagtgcacagtttgcagtAAGAAATTCAACGGATCTGGTCATCTCCGAATTCATCTTAGAACTcatacaggggagaagccATTCGAGTGCGCAGTTTGCAGTAAGAAATTCAACGGATCTGGTCAACTCCGAATTCATCTTAGAACTcatacaggggagaagccattcgagtgcacagtttgcagtAAGAAGTTTAACGTATCTGGTACACTCCGAATTCATCTTAGAACTcacacaggggagaagccATTCGAGTGCTCAGTTTGCAACAAGATGTTTCGTCAAGCTAGTGACCTCCGAGCTCATCTTAGAACCCACACAGGAGAGAGGCCTTTCGAGTGTACAGTTTGCAGAGAAAAGTTTGGTCGAGAATACACCCTTAAAACCCATCTTAAAACCCACAAATCGAAGGAGAAAGAAGCGTTATGA
Protein Sequence: MAGNSWECYACNKTFIKKSTLSSHRRVHHVDRLFECAVCQKKFTHRGSLNRHVRSHTGEKPFECAVCYKKFSETGTLRIHLRTHTGEKPYECTVCNKMWSTASHLRSHLKTHTGEKPFECAVCDKKFSQASSLRTHLKTHTGVKPFECTVCSKKFNESGTLRIHLRTHTGEKPFECTVCSKKFNGSGHLRIHLRTHTGEKPFECAVCSKKFNGSGQLRIHLRTHTGEKPFECTVCSKKFNVSGTLRIHLRTHTGEKPFECSVCNKMFRQASDLRAHLRTHTGERPFECTVCREKFGREYTLKTHLKTHKSKEKEAL

Sequence clustering based on sequence similarity using MMseqs2