Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.15 28 4.6 0.1 20 46 26 52 19 59 0.84

2 8 4.4 8.1e+02 -0.1 0.1 21 44 55 78 51 82 0.79

3 8 7.2e-07 0.00013 21.7 0.1 21 52 83 114 71 115 0.85

4 8 0.019 3.4 7.5 0.1 21 46 111 136 109 142 0.87

5 8 0.0028 0.51 10.2 0.2 22 49 140 167 135 170 0.84

6 8 0.0037 0.67 9.8 0.3 21 46 167 192 163 198 0.86

7 8 0.13 24 4.8 0.1 21 46 195 220 191 226 0.83

8 8 0.00016 0.029 14.1 0.5 21 44 223 246 219 253 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.15	28	4.6	0.1	20	46	26	52	19	59	0.84
2	8	4.4	8.1e+02	-0.1	0.1	21	44	55	78	51	82	0.79
3	8	7.2e-07	0.00013	21.7	0.1	21	52	83	114	71	115	0.85
4	8	0.019	3.4	7.5	0.1	21	46	111	136	109	142	0.87
5	8	0.0028	0.51	10.2	0.2	22	49	140	167	135	170	0.84
6	8	0.0037	0.67	9.8	0.3	21	46	167	192	163	198	0.86
7	8	0.13	24	4.8	0.1	21	46	195	220	191	226	0.83
8	8	0.00016	0.029	14.1	0.5	21	44	223	246	219	253	0.90

Coding Sequence: ATGGCCAAGAAATGCGctgtttgcgccaaaatgtgcCCGAGTTTATCGTCTCTCACTACGCACCTTAGCTCgcacactggggagaagccctTCAAGTGTGCGCTGTGCAGCAAGAGCTTCAGTCTGAAGTGCAACCTTCGGAGCCATGTTCggacccacaccggggagaagcctttccagTGTACGCTGTGCAGCAAGAGCTTCAGTCTGAAGGGCAGCCTTCGGAGCCATGTTCGAACACACACTGGTGAGAAGCCGTTTAAATGCTCCGTGTGCTATGCGAATTTTAGGCAGGAAGCCCACCTTCGGAACCATCTTCATatccacactggggagaagccttttgaaTGCTCCGTCTGCTGTGTGAAGTTTAGTCAAGAAGCCACCCTTCGGAACCATCTTCGAACCCACACCGGGGATAAGCCTTTTGAATGCTCCGTCTGCAATGCGACGTTTAGACATGAAGCCTCCCTTCGGTACCATCTTCGAACCCACACCACCGAGAAGCCGTTTGAGTGCTCCGTCTGCAAAAGGAAGTACAGTAATGAACCCAACCTTCGTCGCCATCTGCGAACCCACACTGGTGAGAAGCCTTATAAATGCTCCGTCTGCAACGTGAAGTTCAGTCGTGAAGACCACCTTCGGAGCCATCTTCGaacccacaccggggagaagccttttgagtgcTCCGTCTGCAATGCGAAATTCAGTGCCAGTTGCAACCTTCGTCGTCATGTTCGCAACCACATTGTGGAGAAGGCTTAG
Protein Sequence: MAKKCAVCAKMCPSLSSLTTHLSSHTGEKPFKCALCSKSFSLKCNLRSHVRTHTGEKPFQCTLCSKSFSLKGSLRSHVRTHTGEKPFKCSVCYANFRQEAHLRNHLHIHTGEKPFECSVCCVKFSQEATLRNHLRTHTGDKPFECSVCNATFRHEASLRYHLRTHTTEKPFECSVCKRKYSNEPNLRRHLRTHTGEKPYKCSVCNVKFSREDHLRSHLRTHTGEKPFECSVCNAKFSASCNLRRHVRNHIVEKA

Sequence clustering based on sequence similarity using MMseqs2